Gene/Proteome Database (LMPD)
LMPD ID
LMP001867
Gene ID
Species
Homo sapiens (Human)
Gene Name
retinoic acid receptor, beta
Gene Symbol
Synonyms
HAP; MCOPS12; NR1B2; RRB2
Chromosome
3
Map Location
3p24.2
Summary
This gene encodes retinoic acid receptor beta, a member of the thyroid-steroid hormone receptor superfamily of nuclear transcriptional regulators. This receptor localizes to the cytoplasm and to subnuclear compartments. It binds retinoic acid, the biologically active form of vitamin A which mediates cellular signalling in embryonic morphogenesis, cell growth and differentiation. It is thought that this protein limits growth of many cell types by regulating gene expression. The gene was first identified in a hepatocellular carcinoma where it flanks a hepatitis B virus integration site. Alternate promoter usage and differential splicing result in multiple transcript variants. [provided by RefSeq, Mar 2014]
Orthologs
Proteins
| retinoic acid receptor beta isoform 1 | |
|---|---|
| Refseq ID | NP_000956 |
| Protein GI | 14916494 |
| UniProt ID | Q86UC5 |
| mRNA ID | NM_000965 |
| Length | 448 |
| RefSeq Status | REVIEWED |
| MFDCMDVLSVSPGQILDFYTASPSSCMLQEKALKACFSGLTQTEWQHRHTAQSIETQSTSSEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMIYTCHRDKNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKETSKQECTESYEMTAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALKIYIRKRRPSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSSSGNTAEHSPSISPSSVENSGVSQSPLVQ | |
| retinoic acid receptor beta isoform 2 | |
|---|---|
| Refseq ID | NP_001277146 |
| Protein GI | 590122018 |
| UniProt ID | Q5QHG3 |
| mRNA ID | NM_001290217 |
| Length | 336 |
| RefSeq Status | REVIEWED |
| MIYTCHRDKNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKETSKQECTESYEMTAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALKIYIRKRRPSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSSSGNTAEHSPSISPSSVENSGVSQSPLVQ | |
| retinoic acid receptor beta isoform 2 | |
|---|---|
| Refseq ID | NP_057236 |
| Protein GI | 7706625 |
| UniProt ID | Q5QHG3 |
| mRNA ID | NM_016152 |
| Length | 336 |
| RefSeq Status | REVIEWED |
| Protein sequence is identical to GI:590122018 (mRNA isoform) | |
| retinoic acid receptor beta isoform 2 | |
|---|---|
| Refseq ID | NP_001277205 |
| Protein GI | 590122040 |
| UniProt ID | Q86UC5 |
| mRNA ID | NM_001290276 |
| Length | 336 |
| RefSeq Status | REVIEWED |
| Protein sequence is identical to GI:590122018 (mRNA isoform) | |
| retinoic acid receptor beta isoform 3 | |
|---|---|
| Refseq ID | NP_001277145 |
| Protein GI | 590122016 |
| UniProt ID | P10826 |
| mRNA ID | NM_001290216 |
| Length | 455 |
| RefSeq Status | REVIEWED |
| MTTSGHACPVPAVNGHMTHYPATPYPLLFPPVIGGLSLPPLHGLHGHPPPSGCSTPSPATIETQSTSSEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMIYTCHRDKNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKETSKQECTESYEMTAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALKIYIRKRRPSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSSSGNTAEHSPSISPSSVENSGVSQSPLVQ | |
| retinoic acid receptor beta isoform 4 | |
|---|---|
| Refseq ID | NP_001277195 |
| Protein GI | 590122018 |
| UniProt ID | P10826 |
| mRNA ID | NM_001290266 |
| Length | 336 |
| RefSeq Status | REVIEWED |
| MIYTCHRDKNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKETSKQECTESYEMTAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALKIYIRKRRPSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSSSGNTAEHSPSISPSSVENSGVSQSPLVQ | |
| retinoic acid receptor beta isoform 6 | |
|---|---|
| Refseq ID | NP_001277229 |
| Protein GI | 590122040 |
| UniProt ID | Q3SB16 |
| mRNA ID | NM_001290300 |
| Length | 336 |
| RefSeq Status | REVIEWED |
| Protein sequence is identical to GI:590122018 (mRNA isoform) | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005737 | IEA:UniProtKB-KW | C | cytoplasm |
| GO:0005654 | TAS:Reactome | C | nucleoplasm |
| GO:0005634 | IDA:UniProtKB | C | nucleus |
| GO:0003677 | TAS:ProtInc | F | DNA binding |
| GO:0000977 | IEA:Ensembl | F | RNA polymerase II regulatory region sequence-specific DNA binding |
| GO:0008144 | IEA:Ensembl | F | drug binding |
| GO:0003708 | TAS:ProtInc | F | retinoic acid receptor activity |
| GO:0003707 | IEA:InterPro | F | steroid hormone receptor activity |
| GO:0008270 | IEA:InterPro | F | zinc ion binding |
| GO:0048566 | IMP:DFLAT | P | embryonic digestive tract development |
| GO:0048048 | IEA:Ensembl | P | embryonic eye morphogenesis |
| GO:0035116 | IEA:Ensembl | P | embryonic hindlimb morphogenesis |
| GO:0010467 | TAS:Reactome | P | gene expression |
| GO:0002068 | IEA:Ensembl | P | glandular epithelial cell development |
| GO:0003417 | IEA:Ensembl | P | growth plate cartilage development |
| GO:0035264 | IEA:Ensembl | P | multicellular organism growth |
| GO:0043066 | IEA:Ensembl | P | negative regulation of apoptotic process |
| GO:0061037 | IEA:Ensembl | P | negative regulation of cartilage development |
| GO:0008285 | IEA:Ensembl | P | negative regulation of cell proliferation |
| GO:0032331 | IEA:Ensembl | P | negative regulation of chondrocyte differentiation |
| GO:0000122 | IEA:Ensembl | P | negative regulation of transcription from RNA polymerase II promoter |
| GO:0003148 | IEA:Ensembl | P | outflow tract septum morphogenesis |
| GO:0043065 | IEA:Ensembl | P | positive regulation of apoptotic process |
| GO:0008284 | IEA:Ensembl | P | positive regulation of cell proliferation |
| GO:0045666 | IEA:Ensembl | P | positive regulation of neuron differentiation |
| GO:0045944 | IEA:Ensembl | P | positive regulation of transcription from RNA polymerase II promoter |
| GO:0031641 | IEA:Ensembl | P | regulation of myelination |
| GO:0003406 | IEA:Ensembl | P | retinal pigment epithelium development |
| GO:0007165 | TAS:ProtInc | P | signal transduction |
| GO:0021756 | IEA:Ensembl | P | striatum development |
| GO:0006367 | TAS:Reactome | P | transcription initiation from RNA polymerase II promoter |
| GO:0001657 | IEA:Ensembl | P | ureteric bud development |
| GO:0055012 | IEA:Ensembl | P | ventricular cardiac muscle cell differentiation |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| hsa05223 | Non-small cell lung cancer |
Domain Information
InterPro Annotations
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=4; Name=Beta-1; IsoId=P10826-1; Sequence=Displayed; Name=Beta-2; IsoId=P10826-2; Sequence=VSP_003634; Name=Beta-3; IsoId=P10826-4; Sequence=Not described; Name=Beta-4; IsoId=P10826-3; Sequence=VSP_003635; |
| Disease | Microphthalmia, syndromic, 12 (MCOPS12) [MIM |
| Domain | Composed of three domains: a modulating N-terminal domain, a DNA-binding domain and a C-terminal ligand-binding domain. |
| Function | Receptor for retinoic acid. Retinoic acid receptors bind as heterodimers to their target response elements in response to their ligands, all-trans or 9-cis retinoic acid, and regulate gene expression in various biological processes. The RXR/RAR heterodimers bind to the retinoic acid response elements (RARE) composed of tandem 5'-AGGTCA-3' sites known as DR1-DR5. In the absence or presence of hormone ligand, acts mainly as an activator of gene expression due to weak binding to corepressors. In concert with RARG, required for skeletal growth, matrix homeostasis and growth plate function. |
| Interaction | P03255:- (xeno); NbExp=2; IntAct=EBI-8583223, EBI-2603114; |
| Sequence Caution | Sequence=CAA27637.1; Type=Erroneous gene model prediction; Evidence= ; |
| Similarity | Belongs to the nuclear hormone receptor family. NR1 subfamily. |
| Similarity | Contains 1 nuclear receptor DNA-binding domain. |
| Subcellular Location | Isoform Beta-1: Nucleus. |
| Subcellular Location | Isoform Beta-2: Nucleus. |
| Subcellular Location | Isoform Beta-4: Cytoplasm. |
| Subunit | Homodimer (By similarity). Heterodimer; with a RXR molecule. Binds DNA preferentially as a RAR/RXR heterodimer (By similarity). Interacts weakly with NCOR2. {ECO |
Identical and Related Proteins
Unique RefSeq proteins for LMP001867 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 14916494 | RefSeq | NP_000956 | 448 | retinoic acid receptor beta isoform 1 |
| 590122018 | RefSeq | NP_001277146 | 336 | retinoic acid receptor beta isoform 2 |
| 590122016 | RefSeq | NP_001277145 | 455 | retinoic acid receptor beta isoform 3 |
| 590122018 | RefSeq | NP_001277195 | 336 | retinoic acid receptor beta isoform 4 |
Identical Sequences to LMP001867 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:14916494 | GenBank | AGD01417.1 | 448 | Sequence 940 from patent US 8338124 |
| GI:14916494 | GenBank | AHD74748.1 | 448 | Sequence 14765 from patent US 8586006 |
| GI:14916494 | GenBank | AIC49569.1 | 448 | RARB, partial [synthetic construct] |
| GI:14916494 | RefSeq | XP_004033801.1 | 448 | PREDICTED: retinoic acid receptor beta isoform 1 [Gorilla gorilla gorilla] |
| GI:590122016 | RefSeq | XP_005545685.1 | 455 | PREDICTED: retinoic acid receptor beta isoform X1 [Macaca fascicularis] |
| GI:14916494 | RefSeq | XP_005545686.1 | 448 | PREDICTED: retinoic acid receptor beta isoform X2 [Macaca fascicularis] |
| GI:590122018 | RefSeq | NP_001277205.1 | 336 | retinoic acid receptor beta isoform 2 [Homo sapiens] |
| GI:590122018 | RefSeq | NP_001277205.1 | 336 | retinoic acid receptor beta isoform 2 [Homo sapiens] |
| GI:590122018 | RefSeq | XP_009200069.1 | 336 | PREDICTED: retinoic acid receptor beta isoform X2 [Papio anubis] |
| GI:590122018 | RefSeq | XP_009200069.1 | 336 | PREDICTED: retinoic acid receptor beta isoform X2 [Papio anubis] |
| GI:590122018 | RefSeq | XP_009200070.1 | 336 | PREDICTED: retinoic acid receptor beta isoform X2 [Papio anubis] |
| GI:590122018 | RefSeq | XP_009200070.1 | 336 | PREDICTED: retinoic acid receptor beta isoform X2 [Papio anubis] |
| GI:590122016 | RefSeq | XP_009443303.1 | 455 | PREDICTED: retinoic acid receptor beta isoform X1 [Pan troglodytes] |
| GI:590122018 | RefSeq | XP_009443304.1 | 336 | PREDICTED: retinoic acid receptor beta isoform X3 [Pan troglodytes] |
| GI:590122018 | RefSeq | XP_009443304.1 | 336 | PREDICTED: retinoic acid receptor beta isoform X3 [Pan troglodytes] |
| GI:590122018 | RefSeq | XP_009443305.1 | 336 | PREDICTED: retinoic acid receptor beta isoform X3 [Pan troglodytes] |
| GI:590122018 | RefSeq | XP_009443305.1 | 336 | PREDICTED: retinoic acid receptor beta isoform X3 [Pan troglodytes] |
| GI:590122018 | RefSeq | XP_009443306.1 | 336 | PREDICTED: retinoic acid receptor beta isoform X3 [Pan troglodytes] |
| GI:590122018 | RefSeq | XP_009443306.1 | 336 | PREDICTED: retinoic acid receptor beta isoform X3 [Pan troglodytes] |
| GI:14916494 | RefSeq | XP_010356303.1 | 448 | PREDICTED: retinoic acid receptor beta [Rhinopithecus roxellana] |
| GI:590122016 | SwissProt | P10826.2 | 455 | RecName: Full=Retinoic acid receptor beta; Short=RAR-beta; AltName: Full=HBV-activated protein; AltName: Full=Nuclear receptor subfamily 1 group B member 2; AltName: Full=RAR-epsilon [Homo sapiens] |
Related Sequences to LMP001867 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:14916494 | DBBJ | BAF84721.1 | 448 | unnamed protein product [Homo sapiens] |
| GI:590122018 | DBBJ | BAJ20818.1 | 448 | retinoic acid receptor, beta, partial [synthetic construct] |
| GI:590122018 | DBBJ | BAJ20818.1 | 448 | retinoic acid receptor, beta, partial [synthetic construct] |
| GI:14916494 | GenBank | AAQ70359.1 | 448 | Sequence 2 from patent US 5223606 |
| GI:14916494 | GenBank | ACM83441.1 | 459 | Sequence 8939 from patent US 6812339 |
| GI:14916494 | GenBank | ACM83442.1 | 459 | Sequence 8940 from patent US 6812339 |
| GI:14916494 | pat | WO | 448 | Sequence 9 from Patent WO 8905854 |
| GI:14916494 | PRF | - | 448 | retinoic acid receptor [Homo sapiens] |
| GI:590122018 | PRF | - | 448 | retinoic acid receptor [Homo sapiens] |
| GI:590122018 | PRF | - | 448 | retinoic acid receptor [Homo sapiens] |
| GI:590122016 | RefSeq | XP_002716265.1 | 455 | PREDICTED: retinoic acid receptor beta isoform X1 [Oryctolagus cuniculus] |
| GI:590122016 | RefSeq | XP_005387545.1 | 455 | PREDICTED: retinoic acid receptor beta isoform X2 [Chinchilla lanigera] |
| GI:590122018 | RefSeq | XP_005545685.1 | 455 | PREDICTED: retinoic acid receptor beta isoform X1 [Macaca fascicularis] |
| GI:590122018 | RefSeq | XP_005545685.1 | 455 | PREDICTED: retinoic acid receptor beta isoform X1 [Macaca fascicularis] |
| GI:590122016 | RefSeq | XP_006153384.1 | 455 | PREDICTED: retinoic acid receptor beta isoform X1 [Tupaia chinensis] |
| GI:590122018 | RefSeq | NP_001277145.1 | 455 | retinoic acid receptor beta isoform 3 [Homo sapiens] |
| GI:590122018 | RefSeq | NP_001277145.1 | 455 | retinoic acid receptor beta isoform 3 [Homo sapiens] |
| GI:590122016 | RefSeq | XP_008007485.1 | 455 | PREDICTED: retinoic acid receptor beta isoform X1 [Chlorocebus sabaeus] |
| GI:590122016 | RefSeq | XP_008516546.1 | 455 | PREDICTED: retinoic acid receptor beta isoform X1 [Equus przewalskii] |
| GI:590122018 | RefSeq | XP_009443303.1 | 455 | PREDICTED: retinoic acid receptor beta isoform X1 [Pan troglodytes] |
| GI:590122018 | RefSeq | XP_009443303.1 | 455 | PREDICTED: retinoic acid receptor beta isoform X1 [Pan troglodytes] |
| GI:590122016 | RefSeq | XP_010344847.1 | 455 | PREDICTED: retinoic acid receptor beta isoform X1 [Saimiri boliviensis boliviensis] |
| GI:590122018 | SwissProt | P10826.2 | 455 | RecName: Full=Retinoic acid receptor beta; Short=RAR-beta; AltName: Full=HBV-activated protein; AltName: Full=Nuclear receptor subfamily 1 group B member 2; AltName: Full=RAR-epsilon [Homo sapiens] |
| GI:590122018 | SwissProt | P10826.2 | 455 | RecName: Full=Retinoic acid receptor beta; Short=RAR-beta; AltName: Full=HBV-activated protein; AltName: Full=Nuclear receptor subfamily 1 group B member 2; AltName: Full=RAR-epsilon [Homo sapiens] |