Gene/Proteome Database (LMPD)
Proteins
| group IIF secretory phospholipase A2 | |
|---|---|
| Refseq ID | NP_073730 |
| Protein GI | 145553989 |
| UniProt ID | Q9BZM2 |
| mRNA ID | NM_022819 |
| Length | 211 |
| RefSeq Status | VALIDATED |
| MADGAKANPKGFKKKVLDRCFSGWRGPRFGASCPSRTSRSSLGMKKFFTVAILAGSVLSTAHGSLLNLKAMVEAVTGRSAILSFVGYGCYCGLGGRGQPKDEVDWCCHAHDCCYQELFDQGCHPYVDHYDHTIENNTEIVCSDLNKTECDKQTCMCDKNMVLCLMNQTYREEYRGFLNVYCQGPTPNCSIYEPPPEEVTCSHQSPAPPAPP | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005829 | TAS:Reactome | C | cytosol |
| GO:0005576 | NAS:UniProtKB | C | extracellular region |
| GO:0005509 | IEA:InterPro | F | calcium ion binding |
| GO:0004623 | NAS:UniProtKB | F | phospholipase A2 activity |
| GO:0046474 | TAS:Reactome | P | glycerophospholipid biosynthetic process |
| GO:0016042 | IEA:UniProtKB-KW | P | lipid catabolic process |
| GO:0006654 | TAS:Reactome | P | phosphatidic acid biosynthetic process |
| GO:0036151 | TAS:Reactome | P | phosphatidylcholine acyl-chain remodeling |
| GO:0036152 | TAS:Reactome | P | phosphatidylethanolamine acyl-chain remodeling |
| GO:0036148 | TAS:Reactome | P | phosphatidylglycerol acyl-chain remodeling |
| GO:0036149 | TAS:Reactome | P | phosphatidylinositol acyl-chain remodeling |
| GO:0036150 | TAS:Reactome | P | phosphatidylserine acyl-chain remodeling |
| GO:0006644 | TAS:Reactome | P | phospholipid metabolic process |
| GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9BZM2-1; Sequence=Displayed; Name=2; IsoId=Q9BZM2-2; Sequence=VSP_037524; |
| Catalytic Activity | Phosphatidylcholine + H(2)O = 1- acylglycerophosphocholine + a carboxylate. {ECO |
| Cofactor | Name=Ca(2+); Xref=ChEBI |
| Function | PA2 catalyzes the calcium-dependent hydrolysis of the 2- acyl groups in 3-sn-phosphoglycerides. Hydrolyzes phosphatidylglycerol versus phosphatidylcholine with a 15-fold preference. |
| Similarity | Belongs to the phospholipase A2 family. |
| Subcellular Location | Secreted . |
| Tissue Specificity | Expressed at high levels in placenta, testis, thymus and at lower levels in heart, kidney, liver and prostate. |
Identical and Related Proteins
Unique RefSeq proteins for LMP001797 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 145553989 | RefSeq | NP_073730 | 211 | group IIF secretory phospholipase A2 |
Identical Sequences to LMP001797 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:145553989 | DBBJ | BAI46973.1 | 211 | phospholipase A2, group IIF, partial [synthetic construct] |
| GI:145553989 | GenBank | EAW94916.1 | 211 | phospholipase A2, group IIF [Homo sapiens] |
| GI:145553989 | GenBank | AAI56848.1 | 211 | Phospholipase A2, group IIF [synthetic construct] |
Related Sequences to LMP001797 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:145553989 | RefSeq | XP_001163707.1 | 211 | PREDICTED: group IIF secretory phospholipase A2 [Pan troglodytes] |
| GI:145553989 | RefSeq | XP_002811422.1 | 211 | PREDICTED: group IIF secretory phospholipase A2 [Pongo abelii] |
| GI:145553989 | RefSeq | XP_003814457.1 | 211 | PREDICTED: group IIF secretory phospholipase A2 [Pan paniscus] |
| GI:145553989 | RefSeq | XP_003935063.1 | 211 | PREDICTED: group IIF secretory phospholipase A2 [Saimiri boliviensis boliviensis] |
| GI:145553989 | RefSeq | XP_004024867.1 | 211 | PREDICTED: group IIF secretory phospholipase A2 [Gorilla gorilla gorilla] |
| GI:145553989 | RefSeq | XP_005544617.1 | 240 | PREDICTED: LOW QUALITY PROTEIN: group IIF secretory phospholipase A2 [Macaca fascicularis] |