Gene/Proteome Database (LMPD)

LMPD ID
LMP001573
Gene ID
19016
Species
Mus musculus (Mouse)
Gene Name
peroxisome proliferator activated receptor gamma
Gene Symbol
Pparg
Synonyms
Nr1c3; PPAR-gamma; PPAR-gamma2; PPARgamma; PPARgamma2
Chromosome
6
Map Location
6 E3-F1|6 53.41 cM

Proteins

peroxisome proliferator-activated receptor gamma isoform 1
Refseq ID NP_001120802
Protein GI 187960105
UniProt ID Q4FJR2
mRNA ID NM_001127330
Length 475
RefSeq Status VALIDATED
MVDTEMPFWPTNFGISSVDLSVMEDHSHSFDIKPFTTVDFSSISAPHYEDIPFTRADPMVADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNRPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKNIPGFINLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKVLQKMTDLRQIVTEHVQLLHVIKKTETDMSLHPLLQEIYKDLY
peroxisome proliferator-activated receptor gamma isoform 2
Refseq ID NP_035276
Protein GI 187960103
UniProt ID Q6GU14
mRNA ID NM_011146
Length 505
RefSeq Status VALIDATED
MGETLGDSPVDPEHGAFADALPMSTSQEITMVDTEMPFWPTNFGISSVDLSVMEDHSHSFDIKPFTTVDFSSISAPHYEDIPFTRADPMVADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNRPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKNIPGFINLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKVLQKMTDLRQIVTEHVQLLHVIKKTETDMSLHPLLQEIYKDLY

Gene Information

Entrez Gene ID
19016
Gene Name
peroxisome proliferator activated receptor gamma
Gene Symbol
Pparg
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005829 IDA:MGI C cytosol
GO:0005634 IDA:MGI C nucleus
GO:0048471 IEA:Ensembl C perinuclear region of cytoplasm
GO:0003677 IDA:MGI F DNA binding
GO:0001012 IDA:MGI F RNA polymerase II regulatory region DNA binding
GO:0001228 IDA:MGI F RNA polymerase II transcription regulatory region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription
GO:0003682 IDA:MGI F chromatin binding
GO:0008144 IEA:Ensembl F drug binding
GO:0004879 TAS:MGI F ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity
GO:0030374 IEA:Ensembl F ligand-dependent nuclear receptor transcription coactivator activity
GO:0043565 IEA:InterPro F sequence-specific DNA binding
GO:0003700 IDA:MGI F sequence-specific DNA binding transcription factor activity
GO:0003707 IEA:InterPro F steroid hormone receptor activity
GO:0008270 IEA:InterPro F zinc ion binding
GO:0006919 IEA:Ensembl P activation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0050873 IDA:MGI P brown fat cell differentiation
GO:0045165 IGI:MGI P cell fate commitment
GO:0048469 IEA:Ensembl P cell maturation
GO:0071455 IEA:Ensembl P cellular response to hyperoxia
GO:0032869 IEA:Ensembl P cellular response to insulin stimulus
GO:0071285 IDA:MGI P cellular response to lithium ion
GO:0071407 IDA:MGI P cellular response to organic cyclic compound
GO:0071380 IEA:Ensembl P cellular response to prostaglandin E stimulus
GO:0071300 IEA:Ensembl P cellular response to retinoic acid
GO:0071306 IEA:Ensembl P cellular response to vitamin E
GO:0030855 IGI:MGI P epithelial cell differentiation
GO:0045444 IDA:MGI P fat cell differentiation
GO:0019395 IEA:Ensembl P fatty acid oxidation
GO:0042593 IEA:Ensembl P glucose homeostasis
GO:0007507 IEA:Ensembl P heart development
GO:0006954 TAS:MGI P inflammatory response
GO:0042953 IEA:Ensembl P lipoprotein transport
GO:0015909 IMP:MGI P long-chain fatty acid transport
GO:0045713 IEA:Ensembl P low-density lipoprotein particle receptor biosynthetic process
GO:0030224 IEA:Ensembl P monocyte differentiation
GO:0002674 IEA:Ensembl P negative regulation of acute inflammatory response
GO:0030308 IEA:Ensembl P negative regulation of cell growth
GO:0008285 IMP:MGI P negative regulation of cell proliferation
GO:0010887 IEA:Ensembl P negative regulation of cholesterol storage
GO:0032966 IEA:Ensembl P negative regulation of collagen biosynthetic process
GO:0060336 IEA:Ensembl P negative regulation of interferon-gamma-mediated signaling pathway
GO:2000230 IEA:Ensembl P negative regulation of pancreatic stellate cell proliferation
GO:0010871 IEA:Ensembl P negative regulation of receptor biosynthetic process
GO:0010891 IEA:Ensembl P negative regulation of sequestering of triglyceride
GO:0048662 IEA:Ensembl P negative regulation of smooth muscle cell proliferation
GO:0051974 IEA:Ensembl P negative regulation of telomerase activity
GO:0000122 IDA:MGI P negative regulation of transcription from RNA polymerase II promoter
GO:0045892 IMP:MGI P negative regulation of transcription, DNA-templated
GO:0031100 IEA:Ensembl P organ regeneration
GO:0035357 IEA:Ensembl P peroxisome proliferator activated receptor signaling pathway
GO:0001890 IMP:MGI P placenta development
GO:0043065 IEA:Ensembl P positive regulation of apoptotic process
GO:0045600 IDA:MGI P positive regulation of fat cell differentiation
GO:0046321 IEA:Ensembl P positive regulation of fatty acid oxidation
GO:0048714 IEA:Ensembl P positive regulation of oligodendrocyte differentiation
GO:0060100 IEA:Ensembl P positive regulation of phagocytosis, engulfment
GO:0051091 IEA:Ensembl P positive regulation of sequence-specific DNA binding transcription factor activity
GO:0045944 IDA:MGI P positive regulation of transcription from RNA polymerase II promoter
GO:0045893 IDA:MGI P positive regulation of transcription, DNA-templated
GO:0008217 IEA:Ensembl P regulation of blood pressure
GO:0045598 IDA:MGI P regulation of fat cell differentiation
GO:0031000 IEA:Ensembl P response to caffeine
GO:0009409 IEA:Ensembl P response to cold
GO:0036270 IEA:Ensembl P response to diuretic
GO:0043627 IEA:Ensembl P response to estrogen
GO:0035902 IEA:Ensembl P response to immobilization stress
GO:0055098 IEA:Ensembl P response to low-density lipoprotein particle
GO:0009612 IEA:Ensembl P response to mechanical stimulus
GO:1901558 IEA:Ensembl P response to metformin
GO:0042594 IEA:Ensembl P response to starvation
GO:0033189 IEA:Ensembl P response to vitamin A
GO:0050872 IDA:MGI P white fat cell differentiation

Domain Information

InterPro Annotations

Accession Description
IPR008946 Nuclear hormone receptor, ligand-binding
IPR000536 Nuclear hormone receptor, ligand-binding, core
IPR003074 Peroxisome proliferator-activated receptor
IPR022590 Peroxisome proliferator-activated receptor gamma, N-terminal
IPR003077 Peroxisome proliferator-activated receptor, gamma
IPR001723 Steroid hormone receptor
IPR013088 Zinc finger, NHR/GATA-type
IPR001628 Zinc finger, nuclear hormone receptor-type

UniProt Annotations

Entry Information

Gene Name
peroxisome proliferator activated receptor gamma
Protein Entry
PPARG_MOUSE
UniProt ID
Q6GU14
Species
Mouse

Comments

Comment Type Description
Similarity Belongs to the nuclear hormone receptor family.
Similarity Contains nuclear receptor DNA-binding domain.

Identical and Related Proteins

Unique RefSeq proteins for LMP001573 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
187960105 RefSeq NP_001120802 475 peroxisome proliferator-activated receptor gamma isoform 1
187960103 RefSeq NP_035276 505 peroxisome proliferator-activated receptor gamma isoform 2

Identical Sequences to LMP001573 proteins

Reference Database Accession Length Protein Name
GI:187960103 DBBJ BAF80899.1 505 peroxisome proliferator-activated receptor gamma [Mus musculus]
GI:187960103 DBBJ BAF80900.1 505 peroxisome proliferator-activated receptor gamma [Mus musculus]
GI:187960105 DBBJ BAM95277.1 475 peroxisome proliferator activated receptor gamma [Mus musculus]
GI:187960103 GenBank AAH21798.1 505 Peroxisome proliferator activated receptor gamma [Mus musculus]
GI:187960103 GenBank AAO45097.1 505 peroxisome proliferator-activated receptor gamma isoform 2 [Mus musculus]
GI:187960103 GenBank AAO45098.1 505 peroxisome proliferator-activated receptor gamma isoform 2 [Mus musculus]
GI:187960103 GenBank AAP42200.1 505 peroxisome proliferator-activated receptor gamma transcript 2 [Mus musculus]
GI:187960105 RefSeq XP_006505803.1 475 PREDICTED: peroxisome proliferator-activated receptor gamma isoform X4 [Mus musculus]
GI:187960105 RefSeq XP_006505804.1 475 PREDICTED: peroxisome proliferator-activated receptor gamma isoform X5 [Mus musculus]
GI:187960105 RefSeq XP_006505805.1 475 PREDICTED: peroxisome proliferator-activated receptor gamma isoform X6 [Mus musculus]
GI:187960105 RefSeq XP_006505806.1 475 PREDICTED: peroxisome proliferator-activated receptor gamma isoform X7 [Mus musculus]
GI:187960105 RefSeq XP_006505807.1 475 PREDICTED: peroxisome proliferator-activated receptor gamma isoform X8 [Mus musculus]

Related Sequences to LMP001573 proteins

Reference Database Accession Length Protein Name
GI:187960105 DBBJ BAF80899.1 505 peroxisome proliferator-activated receptor gamma [Mus musculus]
GI:187960105 DBBJ BAF80900.1 505 peroxisome proliferator-activated receptor gamma [Mus musculus]
GI:187960103 EMBL CAJ18548.1 505 Pparg [Mus musculus]
GI:187960103 GenBank AAA62277.1 505 peroxisome proliferator activated protein-gamma-2 [Mus musculus]
GI:187960103 GenBank AAD40119.1 505 peroxisome proliferator-activated receptor gamma 2 [Rattus norvegicus]
GI:187960105 GenBank AAO45097.1 505 peroxisome proliferator-activated receptor gamma isoform 2 [Mus musculus]
GI:187960105 GenBank AAO45098.1 505 peroxisome proliferator-activated receptor gamma isoform 2 [Mus musculus]
GI:187960105 GenBank AAP42200.1 505 peroxisome proliferator-activated receptor gamma transcript 2 [Mus musculus]
GI:187960103 GenBank ABK39948.1 505 peroxisome proliferator activated receptor gamma 2 [Mus musculus]
GI:187960103 RefSeq NP_037256.1 505 peroxisome proliferator-activated receptor gamma isoform 1 [Rattus norvegicus]
GI:187960105 RefSeq NP_035276.2 505 peroxisome proliferator-activated receptor gamma isoform 2 [Mus musculus]
GI:187960103 SwissProt P37238.3 505 RecName: Full=Peroxisome proliferator-activated receptor gamma; Short=PPAR-gamma; AltName: Full=Nuclear receptor subfamily 1 group C member 3 [Mus musculus]