Gene/Proteome Database (LMPD)
LMPD ID
LMP001568
Gene ID
Species
Homo sapiens (Human)
Gene Name
prostaglandin reductase 1
Gene Symbol
Synonyms
LTB4DH; PGR1; ZADH3
Alternate Names
prostaglandin reductase 1; PRG-1; 15-oxoprostaglandin 13-reductase; leukotriene B4 12-hydroxydehydrogenase; NADP-dependent leukotriene B4 12-hydroxydehydrogenase; zinc binding alcohol dehydrogenase domain containing 3
Chromosome
9
Map Location
9q31.3
EC Number
1.3.1.-
Summary
This gene encodes an enzyme that is involved in the inactivation of the chemotactic factor, leukotriene B4. The encoded protein specifically catalyzes the NADP+ dependent conversion of leukotriene B4 to 12-oxo-leukotriene B4. A pseudogene of this gene is found on chromosome 1. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2009]
Orthologs
Proteins
| prostaglandin reductase 1 isoform 1 | |
|---|---|
| Refseq ID | NP_036344 |
| Protein GI | 226059133 |
| UniProt ID | Q14914 |
| mRNA ID | NM_012212 |
| Length | 329 |
| RefSeq Status | REVIEWED |
| MVRTKTWTLKKHFVGYPTNSDFELKTAELPPLKNGEVLLEALFLTVDPYMRVAAKRLKEGDTMMGQQVAKVVESKNVALPKGTIVLASPGWTTHSISDGKDLEKLLTEWPDTIPLSLALGTVGMPGLTAYFGLLEICGVKGGETVMVNAAAGAVGSVVGQIAKLKGCKVVGAVGSDEKVAYLQKLGFDVVFNYKTVESLEETLKKASPDGYDCYFDNVGGEFSNTVIGQMKKFGRIAICGAISTYNRTGPLPPGPPPEIVIYQELRMEAFVVYRWQGDARQKALKDLLKWVLEGKIQYKEYIIEGFENMPAAFMGMLKGDNLGKTIVKA | |
| prostaglandin reductase 1 isoform 1 | |
|---|---|
| Refseq ID | NP_001139580 |
| Protein GI | 226059159 |
| UniProt ID | Q14914 |
| mRNA ID | NM_001146108 |
| Length | 329 |
| RefSeq Status | REVIEWED |
| Protein sequence is identical to GI:226059133 (mRNA isoform) | |
| prostaglandin reductase 1 isoform 2 | |
|---|---|
| Refseq ID | NP_001139581 |
| Protein GI | 226059159 |
| UniProt ID | Q14914 |
| mRNA ID | NM_001146109 |
| Length | 329 |
| RefSeq Status | REVIEWED |
| Protein sequence is identical to GI:226059133 (mRNA isoform) | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005737 | IEA:UniProtKB-KW | C | cytoplasm |
| GO:0070062 | IDA:UniProt | C | extracellular vesicular exosome |
| GO:0036132 | IEA:UniProtKB-EC | F | 13-prostaglandin reductase activity |
| GO:0047522 | IEA:UniProtKB-EC | F | 15-oxoprostaglandin 13-oxidase activity |
| GO:0032440 | IEA:UniProtKB-EC | F | 2-alkenal reductase [NAD(P)] activity |
| GO:0008270 | IEA:InterPro | F | zinc ion binding |
| GO:0019369 | TAS:Reactome | P | arachidonic acid metabolic process |
| GO:0019371 | TAS:Reactome | P | cyclooxygenase pathway |
| GO:0006691 | NAS:UniProtKB | P | leukotriene metabolic process |
| GO:2001300 | TAS:Reactome | P | lipoxin metabolic process |
| GO:0009636 | IEA:Ensembl | P | response to toxic substance |
| GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
BIOCYC Pathway Links
| BIOCYC Pathway ID | Description |
|---|---|
| PWY3DJ-11470 | sphingosine and sphingosine-1-phosphate metabolism |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_150420 | Synthesis of Leukotrienes (LT) and Eoxins (EX) |
| REACT_150320 | Synthesis of Lipoxins (LX) |
| REACT_150149 | Synthesis of Prostaglandins (PG) and Thromboxanes (TX) |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q14914-1; Sequence=Displayed; Name=2; IsoId=Q14914-2; Sequence=VSP_044652; Note=No experimental confirmation available.; |
| Catalytic Activity | 11-alpha-hydroxy-9,15-dioxoprost-5-enoate + NAD(P)(+) = (5Z)-(13E)-11-alpha-hydroxy-9,15-dioxoprosta-5,13- dienoate + NAD(P)H. |
| Catalytic Activity | A n-alkanal + NAD(P)(+) = an alk-2-enal + NAD(P)H. |
| Function | Functions as 15-oxo-prostaglandin 13-reductase and acts on 15-oxo-PGE1, 15-oxo-PGE2 and 15-oxo-PGE2-alpha. Has no activity towards PGE1, PGE2 and PGE2-alpha (By similarity). Catalyzes the conversion of leukotriene B4 into its biologically less active metabolite, 12-oxo-leukotriene B4. This is an initial and key step of metabolic inactivation of leukotriene B4. |
| Similarity | Belongs to the NADP-dependent oxidoreductase L4BD family. |
| Subcellular Location | Cytoplasm. |
| Subunit | Monomer or homodimer. |
| Tissue Specificity | High expression in the kidney, liver, and intestine but not in leukocytes. |
Identical and Related Proteins
Unique RefSeq proteins for LMP001568 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 226059133 | RefSeq | NP_036344 | 329 | prostaglandin reductase 1 isoform 1 |
Identical Sequences to LMP001568 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:226059133 | RefSeq | NP_001139580.1 | 329 | prostaglandin reductase 1 isoform 1 [Homo sapiens] |
| GI:226059133 | SwissProt | Q14914.2 | 329 | RecName: Full=Prostaglandin reductase 1; Short=PRG-1; AltName: Full=15-oxoprostaglandin 13-reductase; AltName: Full=NADP-dependent leukotriene B4 12-hydroxydehydrogenase [Homo sapiens] |
Related Sequences to LMP001568 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:226059133 | DBBJ | BAF82286.1 | 329 | unnamed protein product [Homo sapiens] |
| GI:226059133 | GenBank | AAH35228.1 | 329 | Prostaglandin reductase 1 [Homo sapiens] |
| GI:226059133 | GenBank | EAW59074.1 | 329 | leukotriene B4 12-hydroxydehydrogenase, isoform CRA_a [Homo sapiens] |
| GI:226059133 | GenBank | EAW59075.1 | 329 | leukotriene B4 12-hydroxydehydrogenase, isoform CRA_a [Homo sapiens] |
| GI:226059133 | GenBank | ADL96437.1 | 329 | Sequence 3 from patent US 7718385 |
| GI:226059133 | GenBank | AHE01310.1 | 329 | Sequence 56226 from patent US 8586006 |