LIPID MAPS

LMPD ID

LMP001557

Gene ID

14079

Species

Mus musculus (Mouse)

Gene Name

fatty acid binding protein 2, intestinal

Gene Symbol

Fabp2

Synonyms

Fabpi; I-FABP

Alternate Names

fatty acid-binding protein, intestinal; intestinal fatty acid binding protein 2; intestinal-type fatty acid-binding protein

Chromosome

3

Map Location

3 G1|3 53.74 cM

Summary

The protein encoded by this gene is part of the fatty acid binding protein family (FABP). FABPs are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands and participate in fatty acid uptake, transport, and metabolism. This protein functions within enterocytes, possibly to sense lipids as part of energy homeostasis. In humans polymorphisms are associated with increased fat oxidation and insulin resistance. In mice deficiency of this gene alters body weight in a gender-specific manner and causes hyperinsulinemia. [provided by RefSeq, Jan 2013]

Orthologs

View orthologs and multiple alignments for Fabp2

fatty acid-binding protein, intestinal
Refseq ID	NP_032006
Protein GI	6679737
UniProt ID	P55050
mRNA ID	NM_007980
Length	132
RefSeq Status	REVIEWED
MAFDGTWKVDRNENYEKFMEKMGINVMKRKLGAHDNLKLTITQDGNKFTVKESSNFRNIDVVFELGVNFPYSLADGTELTGAWTIEGNKLIGKFTRVDNGKELIAVREVSGNELIQTYTYEGVEAKRFFKKE

Entrez Gene ID

14079

Gene Name

fatty acid binding protein 2, intestinal

Gene Symbol

Fabp2

Species

Mus musculus

Gene Ontology (GO Annotations)

GO ID	Source	Type	Description
GO:0005737	IEA:UniProtKB-KW	C	cytoplasm
GO:0005622	IDA:MGI	C	intracellular
GO:0008289	IEA:UniProtKB-KW	F	lipid binding
GO:0005215	IEA:InterPro	F	transporter activity

KEGG Pathway Links

KEGG Pathway ID	Description
ko04975	Fat digestion and absorption
mmu04975	Fat digestion and absorption
mmu03320	PPAR signaling pathway

InterPro Annotations

Accession	Description
IPR012674	Calycin
IPR011038	Calycin-like
IPR000463	Cytosolic fatty-acid binding
IPR000566	Lipocalin/cytosolic fatty-acid binding domain

Entry Information

Gene Name

fatty acid binding protein 2, intestinal

Protein Entry

FABPI_MOUSE

UniProt ID

P55050

Species

Mouse

Comments

Comment Type	Description
Domain	Forms a beta-barrel structure that accommodates the hydrophobic ligand in its interior. {ECO:0000250}.
Function	FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters. FABP2 is probably involved in triglyceride-rich lipoprotein synthesis. Binds saturated long-chain fatty acids with a high affinity, but binds with a lower affinity to unsaturated long- chain fatty acids. FABP2 may also help maintain energy homeostasis by functioning as a lipid sensor. {ECO:0000269\|PubMed:11023988}.
Similarity	Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family. {ECO:0000305}.
Subcellular Location	Cytoplasm.
Tissue Specificity	Expressed in the small intestine. Highest expression levels in the proximal ileum. {ECO:0000269\|PubMed:9277406}.

Unique RefSeq proteins for LMP001557 (as displayed in Record Overview)

Protein GI	Database	Accession	Length	Protein Name
6679737	RefSeq	NP_032006	132	fatty acid-binding protein, intestinal

Identical Sequences to LMP001557 proteins

Reference	Database	Accession	Length	Protein Name
GI:6679737	DBBJ	BAB25397.1	132	unnamed protein product [Mus musculus]
GI:6679737	GenBank	AAH13457.1	132	Fatty acid binding protein 2, intestinal [Mus musculus]
GI:6679737	GenBank	AAS00549.1	132	intestinal fatty acid binding protein 2 [Mus musculus]
GI:6679737	GenBank	AAS00550.1	132	intestinal fatty acid binding protein 2 [Mus musculus]
GI:6679737	GenBank	EDL12315.1	132	fatty acid binding protein 2, intestinal [Mus musculus]
GI:6679737	SwissProt	P55050.2	132	RecName: Full=Fatty acid-binding protein, intestinal; AltName: Full=Fatty acid-binding protein 2; AltName: Full=Intestinal-type fatty acid-binding protein; Short=I-FABP [Mus musculus]

Related Sequences to LMP001557 proteins

Reference	Database	Accession	Length	Protein Name
GI:6679737	GenBank	AGA40477.1	132	Sequence 21 from patent US 8321143
GI:6679737	PDB	1IFC	132	Chain A, Refinement Of The Structure Of Recombinant Rat Intestinal Fatty Acid- Binding Apoprotein At 1.2 Angstroms Resolution
GI:6679737	PRF	-	132	protein,fatty acid binding [Rattus norvegicus]
GI:6679737	PRF	-	132	protein,fatty acid binding [Rattus norvegicus]
GI:6679737	RefSeq	NP_037200.1	132	fatty acid-binding protein, intestinal [Rattus norvegicus]
GI:6679737	SwissProt	P02693.4	132	RecName: Full=Fatty acid-binding protein, intestinal; AltName: Full=Fatty acid-binding protein 2; AltName: Full=Intestinal-type fatty acid-binding protein; Short=I-FABP [Rattus norvegicus]