Gene/Proteome Database (LMPD)
Proteins
| pancreatic lipase-related protein 2 precursor | |
|---|---|
| Refseq ID | NP_005387 |
| Protein GI | 106507261 |
| UniProt ID | P54317 |
| mRNA ID | NM_005396 |
| Length | 470 |
| RefSeq Status | VALIDATED |
| MMLPPWTLGLLLLATVRGKEVCYGQLGCFSDEKPWAGTLQRPVKLLPWSPEDIDTRFLLYTNENPNNFQLITGTEPDTIEASNFQLDRKTRFIIHGFLDKAEDSWPSDMCKKMFEVEKVNCICVDWRHGSRAMYTQAVQNIRVVGAETAFLIQALSTQLGYSLEDVHVIGHSLGAHTAAEAGRRLGGRVGRITGLDPAGPCFQDEPEEVRLDPSDAVFVDVIHTDSSPIVPSLGFGMSQKVGHLDFFPNGGKEMPGCKKNVLSTITDIDGIWEGIGGFVSCNHLRSFEYYSSSVLNPDGFLGYPCASYDEFQESKCFPCPAEGCPKMGHYADQFKGKTSAVEQTFFLNTGESGNFTSWRYKVSVTLSGKEKVNGYIRIALYGSNENSKQYEIFKGSLKPDASHTCAIDVDFNVGKIQKVKFLWNKRGINLSEPKLGASQITVQSGEDGTEYNFCSSDTVEENVLQSLYPC | |
| sig_peptide: 1..18 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 1983 peptide sequence: MMLPPWTLGLLLLATVRG | |
Gene Information
Entrez Gene ID
Gene Name
pancreatic lipase-related protein 2
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005576 | TAS:Reactome | C | extracellular region |
| GO:0005615 | IDA:UniProtKB | C | extracellular space |
| GO:0047372 | IDA:UniProtKB | F | acylglycerol lipase activity |
| GO:0005509 | IDA:UniProtKB | F | calcium ion binding |
| GO:0047714 | IDA:UniProtKB | F | galactolipase activity |
| GO:0004620 | IDA:UniProtKB | F | phospholipase activity |
| GO:0004806 | TAS:ProtInc | F | triglyceride lipase activity |
| GO:0019376 | IDA:UniProtKB | P | galactolipid catabolic process |
| GO:0044241 | TAS:Reactome | P | lipid digestion |
| GO:0009395 | IDA:UniProtKB | P | phospholipid catabolic process |
| GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
| GO:0006641 | TAS:ProtInc | P | triglyceride metabolic process |
KEGG Pathway Links
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_9518 | Digestion of dietary lipid |
Domain Information
UniProt Annotations
Entry Information
Gene Name
pancreatic lipase-related protein 2
Protein Entry
LIPR2_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | 1,2-diacyl-3-beta-D-galactosyl-sn-glycerol + 2 H(2)O = 3-beta-D-galactosyl-sn-glycerol + 2 carboxylates. |
| Catalytic Activity | Triacylglycerol + H(2)O = diacylglycerol + a carboxylate. |
| Function | Lipase with broad substrate specificity. Can hydrolyze both phospholipids and galactolipids. Acts preferentially on monoglycerides, phospholipids and galactolipids. Contributes to milk fat hydrolysis. {ECO |
| Similarity | Belongs to the AB hydrolase superfamily. Lipase family. |
| Similarity | Contains 1 PLAT domain. {ECO |
| Subcellular Location | Secreted {ECO |
| Tissue Specificity | Pancreas. |
Identical and Related Proteins
Unique RefSeq proteins for LMP001541 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 106507261 | RefSeq | NP_005387 | 470 | pancreatic lipase-related protein 2 precursor |
Identical Sequences to LMP001541 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP001541 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:106507261 | EMBL | CAG33230.1 | 469 | PNLIPRP2 [Homo sapiens] |
| GI:106507261 | GenBank | AAA59533.1 | 469 | lipase related protein 2 [Homo sapiens] |
| GI:106507261 | GenBank | AAH05989.1 | 469 | PNLIPRP2 protein [Homo sapiens] |
| GI:106507261 | GenBank | AAP66255.1 | 469 | Sequence 5 from patent US 6558936 |
| GI:106507261 | GenBank | EAW49448.1 | 469 | pancreatic lipase-related protein 2, isoform CRA_b [Homo sapiens] |
| GI:106507261 | SwissProt | P54317.1 | 469 | RecName: Full=Pancreatic lipase-related protein 2; Short=PL-RP2; AltName: Full=Galactolipase; Flags: Precursor [Homo sapiens] |