LIPID MAPS

LMPD ID

LMP001437

Gene ID

51094

Species

Homo sapiens (Human)

Gene Name

adiponectin receptor 1

Gene Symbol

ADIPOR1

Synonyms

ACDCR1; CGI45; PAQR1; TESBP1A

Alternate Names

adiponectin receptor protein 1; progestin and adipoQ receptor family member I

Chromosome

1

Map Location

1q32.1

Summary

This gene encodes a protein which acts as a receptor for adiponectin, a hormone secreted by adipocytes which regulates fatty acid catabolism and glucose levels. Binding of adiponectin to the encoded protein results in activation of an AMP-activated kinase signaling pathway which affects levels of fatty acid oxidation and insulin sensitivity. A pseudogene of this gene is located on chromosome 14. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Mar 2014]

Orthologs

View orthologs and multiple alignments for ADIPOR1

adiponectin receptor protein 1
Refseq ID	NP_057083
Protein GI	21361519
UniProt ID	Q96A54
mRNA ID	NM_015999
Length	375
RefSeq Status	REVIEWED
MSSHKGSVVAQGNGAPASNREADTVELAELGPLLEEKGKRVIANPPKAEEEQTCPVPQEEEEEVRVLTLPLQAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQEFRYGLEGGCTDDTLL

adiponectin receptor protein 1
Refseq ID	NP_001277482
Protein GI	594952025
UniProt ID	Q96A54
mRNA ID	NM_001290553
Length	375
RefSeq Status	REVIEWED
Protein sequence is identical to GI:21361519 (mRNA isoform)

adiponectin receptor protein 1
Refseq ID	NP_001277486
Protein GI	594952027
UniProt ID	Q96A54
mRNA ID	NM_001290557
Length	375
RefSeq Status	REVIEWED
Protein sequence is identical to GI:21361519 (mRNA isoform)

adiponectin receptor protein 1
Refseq ID	NP_001277558
Protein GI	594952032
UniProt ID	Q96A54
mRNA ID	NM_001290629
Length	375
RefSeq Status	REVIEWED
Protein sequence is identical to GI:21361519 (mRNA isoform)

Entrez Gene ID

51094

Gene Name

adiponectin receptor 1

Gene Symbol

ADIPOR1

Species

Homo sapiens

Gene Ontology (GO Annotations)

GO ID	Source	Type	Description
GO:0016021	NAS:UniProtKB	C	integral component of membrane
GO:0016020	IDA:UniProtKB	C	membrane
GO:0005886	IDA:BHF-UCL	C	plasma membrane
GO:0042562	IDA:UniProtKB	F	hormone binding
GO:0019901	IPI:BHF-UCL	F	protein kinase binding
GO:0004872	IBA:RefGenome	F	receptor activity
GO:0033211	IBA:RefGenome	P	adiponectin-activated signaling pathway
GO:0019395	IDA:UniProtKB	P	fatty acid oxidation
GO:0009755	IDA:UniProtKB	P	hormone-mediated signaling pathway
GO:0033210	IEA:Ensembl	P	leptin-mediated signaling pathway
GO:0030308	IEA:Ensembl	P	negative regulation of cell growth
GO:0046427	IEA:Ensembl	P	positive regulation of JAK-STAT cascade
GO:0046628	IEA:Ensembl	P	positive regulation of insulin receptor signaling pathway

KEGG Pathway Links

KEGG Pathway ID	Description
hsa04152	AMPK signaling pathway
hsa04920	Adipocytokine signaling pathway
hsa04932	Non-alcoholic fatty liver disease (NAFLD)

InterPro Annotations

Accession	Description
IPR004254	AdipoR/Haemolysin-III-related

Entry Information

Gene Name

adiponectin receptor 1

Protein Entry

ADR1_HUMAN

UniProt ID

Q96A54

Species

Human

Comments

Comment Type	Description
Domain	The N-terminus is known to be cytoplasmic while the C- terminus is known to be extracellular.
Function	Receptor for globular and full-length adiponectin (APM1), an essential hormone secreted by adipocytes that acts as an antidiabetic. Probably involved in metabolic pathways that regulate lipid metabolism such as fatty acid oxidation. Mediates increased AMPK, PPARA ligand activity, fatty acid oxidation and glucose uptake by adiponectin. Has some high-affinity receptor for globular adiponectin but low-affinity receptor for full-length adiponectin.
Interaction	Self; NbExp=3; IntAct=EBI-1632076, EBI-1632076; Q9UKG1:APPL1; NbExp=6; IntAct=EBI-1632076, EBI-741243;
Sequence Caution	Sequence=AAD34040.1; Type=Frameshift; Positions=369; Evidence= ;
Similarity	Belongs to the ADIPOR family.
Subcellular Location	Membrane ; Multi-pass membrane protein . Note=Localized to the cell membrane and intracellular organelles.
Subunit	May form homomultimer and heteromultimers.
Tissue Specificity	Widely expressed. Highly expressed in skeletal muscle. Expressed at intermediate level in brain, heart, spleen, kidney, liver, placenta, lung and peripheral blood leukocytes. Weakly expressed in colon, thymus and small intestine.
Web Resource	Name=Atlas of Genetics and Cytogenetics in Oncology and Haematology; URL="http://atlasgeneticsoncology.org/Genes/ADIPOR1ID44512ch1q32.html";

Unique RefSeq proteins for LMP001437 (as displayed in Record Overview)

Protein GI	Database	Accession	Length	Protein Name
21361519	RefSeq	NP_057083	375	adiponectin receptor protein 1

Identical Sequences to LMP001437 proteins

Reference	Database	Accession	Length	Protein Name
GI:21361519	GenBank	AIC51393.1	375	ADIPOR1, partial [synthetic construct]
GI:21361519	RefSeq	XP_008974859.1	375	PREDICTED: adiponectin receptor protein 1 [Pan paniscus]
GI:21361519	RefSeq	XP_008974860.1	375	PREDICTED: adiponectin receptor protein 1 [Pan paniscus]
GI:21361519	RefSeq	XP_009439191.1	375	PREDICTED: adiponectin receptor protein 1 [Pan troglodytes]
GI:21361519	RefSeq	XP_009439193.1	375	PREDICTED: adiponectin receptor protein 1 [Pan troglodytes]
GI:21361519	RefSeq	XP_009439197.1	375	PREDICTED: adiponectin receptor protein 1 [Pan troglodytes]

Related Sequences to LMP001437 proteins

Reference	Database	Accession	Length	Protein Name
GI:21361519	DBBJ	BAD96223.1	375	adiponectin receptor 1 variant, partial [Homo sapiens]
GI:21361519	DBBJ	BAG50922.1	375	unnamed protein product [Homo sapiens]
GI:21361519	EMBL	CAE89455.1	375	unnamed protein product [Homo sapiens]
GI:21361519	GenBank	AFN99342.1	375	Sequence 48 from patent US 8093017
GI:21361519	RefSeq	XP_004481959.1	375	PREDICTED: adiponectin receptor protein 1 isoform 2 [Dasypus novemcinctus]
GI:21361519	RefSeq	XP_004481960.1	375	PREDICTED: adiponectin receptor protein 1 isoform 3 [Dasypus novemcinctus]