Gene/Proteome Database (LMPD)

LMPD ID
LMP001419
Gene ID
18762
Species
Mus musculus (Mouse)
Gene Name
protein kinase C, zeta
Gene Symbol
Prkcz
Synonyms
AI098070; C80388; Pkcz; R74924; aPKCzeta; nPKC-zeta; zetaPKC
Alternate Names
protein kinase C zeta type; atypical protein kinase C; protein kinase C zeta subspecies
Chromosome
4
Map Location
4 E2|4 86.17 cM
EC Number
2.7.11.13

Proteins

protein kinase C zeta type isoform a
Refseq ID NP_032886
Protein GI 84872200
UniProt ID Q02956
mRNA ID NM_008860
Length 592
RefSeq Status VALIDATED
MPSRTDPKMDRSGGRVRLKAHYGGDILITSVDAMTTFKDLCEEVRDMCGLHQQHPLTLKWVDSEGDPCTVSSQMELEEAFRLVCQGRDEVLIIHVFPSIPEQPGMPCPGEDKSIYRRGARRWRKLYRANGHLFQAKRFNRGAYCGQCSERIWGLSRQGYRCINCKLLVHKRCHVLVPLTCRRHMDSVMPSQEPPVDDKNDGVDLPSEETDGIAYISSSRKHDNIKDDSEDLKPVIDGVDGIKISQGLGLQDFDLIRVIGRGSYAKVLLVRLKKNDQIYAMKVVKKELVHDDEDIDWVQTEKHVFEQASSNPFLVGLHSCFQTTSRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEICIALNFLHERGIIYRDLKLDNVLLDADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAPEILRGEEYGFSVDWWALGVLMFEMMAGRSPFDIITDNPDMNTEDYLFQVILEKPIRIPRFLSVKASHVLKGFLNKDPKERLGCRPQTGFSDIKSHAFFRSIDWDLLEKKQTLPPFQPQITDDYGLDNFDTQFTSEPVQLTPDDEDVIKRIDQSEFEGFEYINPLLLSAEESV
protein kinase C zeta type isoform b
Refseq ID NP_001034168
Protein GI 84872205
UniProt ID Q3V341
mRNA ID NM_001039079
Length 409
RefSeq Status VALIDATED
MDSVMPSQEPPVDDKNDGVDLPSEETDGIAYISSSRKHDNIKDDSEDLKPVIDGVDGIKISQGLGLQDFDLIRVIGRGSYAKVLLVRLKKNDQIYAMKVVKKELVHDDEDIDWVQTEKHVFEQASSNPFLVGLHSCFQTTSRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEICIALNFLHERGIIYRDLKLDNVLLDADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAPEILRGEEYGFSVDWWALGVLMFEMMAGRSPFDIITDNPDMNTEDYLFQVILEKPIRIPRFLSVKASHVLKGFLNKDPKERLGCRPQTGFSDIKSHAFFRSIDWDLLEKKQTLPPFQPQITDDYGLDNFDTQFTSEPVQLTPDDEDVIKRIDQSEFEGFEYINPLLLSAEESV

Gene Information

Entrez Gene ID
18762
Gene Name
protein kinase C, zeta
Gene Symbol
Prkcz
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0045179 IDA:MGI C apical cortex
GO:0016324 IDA:MGI C apical plasma membrane
GO:0043203 IDA:MGI C axon hillock
GO:0005938 IDA:MGI C cell cortex
GO:0031252 IEA:Ensembl C cell leading edge
GO:0005911 ISS:UniProtKB C cell-cell junction
GO:0005737 IDA:MGI C cytoplasm
GO:0005829 IEA:Ensembl C cytosol
GO:0005768 IEA:UniProtKB-KW C endosome
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0045121 IEA:Ensembl C membrane raft
GO:0005815 IGI:MGI C microtubule organizing center
GO:0035748 IDA:BHF-UCL C myelin sheath abaxonal region
GO:0005635 IDA:MGI C nuclear envelope
GO:0016363 IDA:MGI C nuclear matrix
GO:0005634 IDA:MGI C nucleus
GO:0048471 IEA:Ensembl C perinuclear region of cytoplasm
GO:0005886 IDA:MGI C plasma membrane
GO:0043234 IDA:MGI C protein complex
GO:0005923 IDA:MGI C tight junction
GO:0005524 IEA:UniProtKB-KW F ATP binding
GO:0015459 IEA:Ensembl F potassium channel regulator activity
GO:0004697 IEA:UniProtKB-EC F protein kinase C activity
GO:0004672 IDA:MGI F protein kinase activity
GO:0004674 IDA:UniProtKB F protein serine/threonine kinase activity
GO:0008270 IEA:InterPro F zinc ion binding
GO:0031532 IEA:Ensembl P actin cytoskeleton reorganization
GO:0031584 IEA:Ensembl P activation of phospholipase D activity
GO:0032148 IEA:Ensembl P activation of protein kinase B activity
GO:0016477 IEA:Ensembl P cell migration
GO:0030010 ISS:UniProtKB P establishment of cell polarity
GO:0006954 IEA:UniProtKB-KW P inflammatory response
GO:0008286 IEA:Ensembl P insulin receptor signaling pathway
GO:0007616 IEA:Ensembl P long-term memory
GO:0060291 ISS:UniProtKB P long-term synaptic potentiation
GO:0060081 IEA:Ensembl P membrane hyperpolarization
GO:0000226 IMP:MGI P microtubule cytoskeleton organization
GO:0043066 IEA:Ensembl P negative regulation of apoptotic process
GO:0051346 IEA:Ensembl P negative regulation of hydrolase activity
GO:0046627 IEA:Ensembl P negative regulation of insulin receptor signaling pathway
GO:0050732 IEA:Ensembl P negative regulation of peptidyl-tyrosine phosphorylation
GO:0031333 IEA:Ensembl P negative regulation of protein complex assembly
GO:1990138 IGI:MGI P neuron projection extension
GO:0018105 IEA:Ensembl P peptidyl-serine phosphorylation
GO:0070374 ISS:UniProtKB P positive regulation of ERK1 and ERK2 cascade
GO:0051092 ISS:UniProtKB P positive regulation of NF-kappaB transcription factor activity
GO:2000553 IMP:UniProtKB P positive regulation of T-helper 2 cell cytokine production
GO:0045630 IMP:UniProtKB P positive regulation of T-helper 2 cell differentiation
GO:0008284 IEA:Ensembl P positive regulation of cell proliferation
GO:0001954 IEA:Ensembl P positive regulation of cell-matrix adhesion
GO:2000463 ISS:UniProtKB P positive regulation of excitatory postsynaptic membrane potential
GO:0046326 IEA:Ensembl P positive regulation of glucose import
GO:0046628 ISS:UniProtKB P positive regulation of insulin receptor signaling pathway
GO:2001181 IMP:UniProtKB P positive regulation of interleukin-10 secretion
GO:2000667 IMP:UniProtKB P positive regulation of interleukin-13 secretion
GO:0032753 IMP:UniProtKB P positive regulation of interleukin-4 production
GO:2000664 IMP:UniProtKB P positive regulation of interleukin-5 secretion
GO:0051291 IEA:Ensembl P protein heterooligomerization
GO:0070528 IEA:Ensembl P protein kinase C signaling
GO:0072659 IMP:MGI P protein localization to plasma membrane
GO:0006468 IDA:MGI P protein phosphorylation
GO:0047496 IEA:Ensembl P vesicle transport along microtubule

KEGG Pathway Links

KEGG Pathway ID Description
mmu04390 Hippo signaling pathway
mmu04151 PI3K-Akt signaling pathway
mmu04611 Platelet activation
mmu04015 Rap1 signaling pathway

Domain Information

InterPro Annotations

Accession Description
IPR000961 AGC-kinase, C-terminal
IPR020454 Diacylglycerol/phorbol-ester binding
IPR000270 Phox/Bem1p
IPR012233 Protein kinase C
IPR002219 Protein kinase C-like, phorbol ester/diacylglycerol-binding domain
IPR000719 Protein kinase domain
IPR017441 Protein kinase, ATP binding site
IPR017892 Protein kinase, C-terminal
IPR011009 Protein kinase-like domain
IPR008271 Serine/threonine-protein kinase, active site
IPR002290 Serine/threonine/dual specificity protein kinase, catalytic domain

UniProt Annotations

Entry Information

Gene Name
protein kinase C, zeta
Protein Entry
Q3V341_MOUSE
UniProt ID
Q3V341
Species
Mouse

Comments

Comment Type Description
Catalytic Activity ATP + a protein = ADP + a phosphoprotein.
Domain The C1 domain does not bind the diacylglycerol (DAG).
Domain The OPR domain mediates mutually exclusive interactions with SQSTM1 and PARD6B. {ECO:0000250}.
Enzyme Regulation Atypical PKCs (PRKCI and PRKCZ) exhibit an elevated basal enzymatic activity (that may be due to the interaction with SMG1 or SQSTM1) and are not regulated by diacylglycerol, phosphatidylserine, phorbol esters or calcium ions. Two specific sites, Thr-410 (activation loop of the kinase domain) and Thr-560 (turn motif), need to be phosphorylated for its full activation. Phosphatidylinositol 3,4,5-trisphosphate might be a physiological activator (By similarity). {ECO:0000250}.
Function Calcium- and diacylglycerol-independent serine/threonine-protein kinase that functions in phosphatidylinositol 3-kinase (PI3K) pathway and mitogen-activated protein (MAP) kinase cascade, and is involved in NF-kappa-B activation, mitogenic signaling, cell proliferation, cell polarity, inflammatory response and maintenance of long-term potentiation (LTP). Upon lipopolysaccharide (LPS) treatment in macrophages, or following mitogenic stimuli, functions downstream of PI3K to activate MAP2K1/MEK1-MAPK1/ERK2 signaling cascade independently of RAF1 activation. Required for insulin-dependent activation of AKT3, but may function as an adapter rather than a direct activator. Upon insulin treatment may act as a downstream effector of PI3K and contribute to the activation of translocation of the glucose transporter SLC2A4/GLUT4 and subsequent glucose transport in adipocytes. In EGF-induced cells, binds and activates MAP2K5/MEK5-MAPK7/ERK5 independently of its kinase activity and can activate JUN promoter through MEF2C. Through binding with SQSTM1/p62, functions in interleukin-1 signaling and activation of NF-kappa-B with the specific adapters RIPK1 and TRAF6. Participates in TNF-dependent transactivation of NF-kappa-B by phosphorylating and activating IKBKB kinase, which in turn leads to the degradation of NF-kappa-B inhibitors. In migrating astrocytes, forms a cytoplasmic complex with PARD6A and is recruited by CDC42 to function in the establishment of cell polarity along with the microtubule motor and dynein. In association with FEZ1, stimulates neuronal differentiation in PC12 cells. In the inflammatory response, is required for the T-helper 2 (Th2) differentiation process, including interleukin production, efficient activation of JAK1 and the subsequent phosphorylation and nuclear translocation of STAT6. May be involved in development of allergic airway inflammation (asthma), a process dependent on Th2 immune response. In the NF-kappa-B-mediated inflammatory response, can relieve SETD6-dependent repression of NF-kappa-B target genes by phosphorylating the RELA subunit at 'Ser-311'. Necessary and sufficient for LTP maintenance in hippocampal CA1 pyramidal cells. In vein endothelial cells treated with the oxidant peroxynitrite, phosphorylates STK11 leading to nuclear export of STK11, subsequent inhibition of PI3K/Akt signaling, and increased apoptosis. {ECO:0000269|PubMed:15987782, ECO:0000269|PubMed:21131967}.
Ptm CDH5 is required for its phosphorylation at Thr-410. Phosphorylated by protein kinase PDPK1; phosphorylation is inhibited by the apoptotic C-terminal cleavage product of PKN2. Phosphorylation at Thr-410 by PI3K activates the kinase (By similarity). {ECO:0000250}.
Similarity Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. PKC subfamily. {ECO:0000305}.
Similarity Contains 1 AGC-kinase C-terminal domain. {ECO:0000305}.
Similarity Contains 1 OPR domain. {ECO:0000305}.
Similarity Contains 1 phorbol-ester/DAG-type zinc finger. {ECO:0000255|PROSITE-ProRule:PRU00226}.
Similarity Contains 1 protein kinase domain. {ECO:0000255|PROSITE-ProRule:PRU00159}.
Subcellular Location Cytoplasm {ECO:0000250}. Endosome {ECO:0000250}. Cell junction {ECO:0000250}. Note=In the retina, localizes in the terminals of the rod bipolar cells. Associated with endosomes. Presence of KRIT1, CDH5 and RAP1B is required for its localization to the cell junction (By similarity). {ECO:0000250}.
Subunit Interacts directly with SQSTM1. Forms a ternary complex with SQSTM1 and KCNAB2. Forms another ternary complex with SQSTM1 and GABRR3. Forms a complex with SQSTM1 and MAP2K5 (By similarity). Interacts with PARD6A, PARD6B and PARD6G. Part of a complex with PARD3, PARD6A or PARD6B or PARD6G and CDC42 or RAC1. Interacts with ADAP1/CENTA1. Interacts (via the protein kinase domain) with WWC1. Forms a tripartite complex with WWC1 and DDR1, but predominantly in the absence of collagen. Interacts with PDPK1 (via N-terminal region) (By similarity). {ECO:0000250}.

Identical and Related Proteins

Unique RefSeq proteins for LMP001419 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
84872200 RefSeq NP_032886 592 protein kinase C zeta type isoform a
84872205 RefSeq NP_001034168 409 protein kinase C zeta type isoform b

Identical Sequences to LMP001419 proteins

Reference Database Accession Length Protein Name
GI:84872205 DBBJ BAE43344.1 409 unnamed protein product [Mus musculus]
GI:84872200 GenBank ABK42352.1 592 protein kinase C zeta [synthetic construct]
GI:84872200 GenBank ABK42353.1 592 PKC-zeta [synthetic construct]
GI:84872200 GenBank EDL15000.1 592 protein kinase C, zeta [Mus musculus]
GI:84872205 GenBank EDL81293.1 409 protein kinase C, zeta, isoform CRA_a [Rattus norvegicus]
GI:84872205 GenBank EDL81294.1 409 protein kinase C, zeta, isoform CRA_b [Rattus norvegicus]
GI:84872205 RefSeq XP_006239598.1 409 PREDICTED: protein kinase C zeta type isoform X3 [Rattus norvegicus]
GI:84872205 RefSeq XP_006538719.1 409 PREDICTED: protein kinase C zeta type isoform X3 [Mus musculus]
GI:84872200 SwissProt Q02956.2 592 RecName: Full=Protein kinase C zeta type; AltName: Full=nPKC-zeta [Mus musculus]

Related Sequences to LMP001419 proteins

Reference Database Accession Length Protein Name
GI:84872200 GenBank AAA39983.1 592 protein kinase C zeta [Mus musculus]
GI:84872205 GenBank AAA41878.1 492 protein kinase C zeta subspecies, partial [Rattus sp.]
GI:84872200 GenBank AAA41934.1 592 protein kinase C, zeta subspecies [Rattus norvegicus]
GI:84872205 GenBank ABK42352.1 592 protein kinase C zeta [synthetic construct]
GI:84872205 GenBank ABK42353.1 592 PKC-zeta [synthetic construct]
GI:84872200 GenBank AAI39762.1 592 Protein kinase C, zeta [Mus musculus]
GI:84872205 GenBank EDL15000.1 592 protein kinase C, zeta [Mus musculus]
GI:84872200 GenBank EDL81295.1 592 protein kinase C, zeta, isoform CRA_c [Rattus norvegicus]
GI:84872205 RefSeq NP_032886.2 592 protein kinase C zeta type isoform a [Mus musculus]
GI:84872200 RefSeq XP_005368716.1 592 PREDICTED: protein kinase C zeta type isoform X1 [Microtus ochrogaster]
GI:84872200 SwissProt P09217.2 592 RecName: Full=Protein kinase C zeta type; AltName: Full=nPKC-zeta [Rattus norvegicus]
GI:84872205 SwissProt Q02956.2 592 RecName: Full=Protein kinase C zeta type; AltName: Full=nPKC-zeta [Mus musculus]