Gene/Proteome Database (LMPD)

LMPD ID
LMP001324
Gene ID
Species
Mus musculus (Mouse)
Gene Name
phospholipase A2, group IIA (platelets, synovial fluid)
Gene Symbol
Synonyms
EF; Mom1; Pla2; sPLA2; sPla2-IIA
Alternate Names
phospholipase A2, membrane associated; GIIC sPLA2; enhancing factor; modifier of Min1; group IIA phospholipase A2; phospholipase A2 group IIa; secretory group II phospholipase A2; phosphatidylcholine 2-acylhydrolase 2A; non-pancreatic secreted type II phospholipase A2
Chromosome
4
Map Location
4 D3|4 70.57 cM
EC Number
3.1.1.4
Summary
Proteins belonging to the phospholipase A2 (PLA2) family hydrolyze phospholipids into sn2 fatty acids and lysophospholipids. They function in a variety of cellular processes, including the digestion of phospholipids and the production of molecules that induce inflammatory responses. This gene encodes a member of the group II class of secretory PLA2s. The secreted enzyme binds to heparin on the cell surface. Mutations in this gene increase the occurrence of intestinal polyps caused by a dominant mutation in the adenomatosis polyposis coli gene. A frameshift inactivates this gene product in some mouse strains including the strain of the reference genome, C57BL/6J, whereas a functional protein is produced in other strains. [provided by RefSeq, Jul 2008]
Orthologs

Proteins

phospholipase A2, membrane associated precursor
Refseq ID NP_001076000
Protein GI 132626633
UniProt ID P31482
mRNA ID NM_001082531
Length 146
RefSeq Status REVIEWED
MKVLLLLAASIMAFGSIQVQGNIAQFGEMIRLKTGKRAELSYAFYGCHCGLGGKGSPKDATDRCCVTHDCCYKSLEKSGCGTKLLKYKYSHQGGQITCSANQNSCQKRLCQCDKAAAECFARNKKTYSLKYQFYPNMFCKGKKPKC
sig_peptide: 1..21 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2191 peptide sequence: MKVLLLLAASIMAFGSIQVQG mat_peptide: 22..146 product: phospholipase A2, membrane associated calculated_mol_wt: 13972 peptide sequence: NIAQFGEMIRLKTGKRAELSYAFYGCHCGLGGKGSPKDATDRCCVTHDCCYKSLEKSGCGTKLLKYKYSHQGGQITCSANQNSCQKRLCQCDKAAAECFARNKKTYSLKYQFYPNMFCKGKKPKC

Gene Information

Entrez Gene ID
Gene Name
phospholipase A2, group IIA (platelets, synovial fluid)
Gene Symbol
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016020 IEA:UniProtKB-KW C membrane
GO:0005739 IDA:MGI C mitochondrion
GO:0005509 IEA:InterPro F calcium ion binding
GO:0004623 IEA:UniProtKB-EC F phospholipase A2 activity
GO:0016042 IEA:UniProtKB-KW P lipid catabolic process
GO:0008285 IGI:MGI P negative regulation of cell proliferation
GO:0050680 IGI:MGI P negative regulation of epithelial cell proliferation
GO:0006644 IEA:InterPro P phospholipid metabolic process
GO:0042127 IGI:MGI P regulation of cell proliferation
GO:0050678 IGI:MGI P regulation of epithelial cell proliferation
GO:0040008 IEA:UniProtKB-KW P regulation of growth
GO:0035019 IGI:MGI P somatic stem cell maintenance

KEGG Pathway Links

KEGG Pathway ID Description
mmu04975 Fat digestion and absorption
mmu04014 Ras signaling pathway

Domain Information

InterPro Annotations

Accession Description
IPR001211 Phospholipase A2
IPR016090 Phospholipase A2 domain
IPR013090 Phospholipase A2, active site

UniProt Annotations

Entry Information

Gene Name
phospholipase A2, group IIA (platelets, synovial fluid)
Protein Entry
PA2GA_MOUSE
UniProt ID
Species
Mouse

Comments

Comment Type Description
Catalytic Activity Phosphatidylcholine + H(2)O = 1- acylglycerophosphocholine + a carboxylate. {ECO:0000255|PROSITE- ProRule:PRU10035, ECO:0000255|PROSITE-ProRule:PRU10036}.
Cofactor Name=Ca(2+); Xref=ChEBI:CHEBI:29108; Evidence={ECO:0000250}; Note=Binds 1 Ca(2+) ion per subunit. {ECO:0000250};
Function May play a role in cell proliferation, by increasing the binding of EGF to the cells and thereby modulating its action. In doing so, this isozyme binds to a membrane-associated receptor distinct from the EGF receptor and which could be a heparan- sulfate proteoglycan located on the cell membrane.
Function PA2 catalyzes the calcium-dependent hydrolysis of the 2- acyl groups in 3-sn-phosphoglycerides.
Polymorphism In strains 129/Sv, B10.RIII and C57BL/6, a polymorphism causes a frameshift and premature truncation of the protein, rendering it inactive. Strains BALB/c, C3H/He, DBA/1, DBA/2, MRL and NZB/B1N contain the normal protein while strain CD- 1 is heterozygous for the mutation.
Sequence Caution Sequence=AAB06315.1; Type=Erroneous initiation; Evidence={ECO:0000305};
Similarity Belongs to the phospholipase A2 family. {ECO:0000305}.
Subcellular Location Membrane; Peripheral membrane protein.
Tissue Specificity Mainly in the Paneth cells adjacent to the stem population in the small intestines. Also expressed in regenerating liver and hyperplastic esophageal epithelium.

Identical and Related Proteins

Unique RefSeq proteins for LMP001324 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
132626633 RefSeq NP_001076000 146 phospholipase A2, membrane associated precursor

Identical Sequences to LMP001324 proteins

Reference Database Accession Length Protein Name
GI:132626633 GenBank AAE47930.1 146 Sequence 3 from patent US 6103469
GI:132626633 GenBank AAM60043.1 146 Sequence 3 from patent US 6399301
GI:132626633 GenBank AAH45156.1 146 Pla2g2a protein [Mus musculus]
GI:132626633 GenBank AEU43276.1 146 Sequence 25 from patent US 8052970
GI:132626633 GenBank AHB62392.1 146 phospholipase A2 group IIa [Mus musculus]
GI:132626633 SwissProt P31482.3 146 RecName: Full=Phospholipase A2, membrane associated; AltName: Full=Enhancing factor; Short=EF; AltName: Full=GIIC sPLA2; AltName: Full=Group IIA phospholipase A2; AltName: Full=Phosphatidylcholine 2-acylhydrolase 2A; Flags: Precursor [Mus musculus]

Related Sequences to LMP001324 proteins

Reference Database Accession Length Protein Name
GI:132626633 EMBL CAA52325.1 146 enhancing factor [Mus musculus]
GI:132626633 GenBank AAB06315.1 118 type II phospholipase A2 [Mus musculus]
GI:132626633 GenBank EGV96853.1 146 Phospholipase A2, membrane associated [Cricetulus griseus]
GI:132626633 GenBank AHB62391.1 132 phospholipase A2 group IIa, partial [Mus musculus]
GI:132626633 GenBank AHB62397.1 146 phospholipase A2 group IIa [Mus musculus]
GI:132626633 RefSeq XP_007645636.1 146 PREDICTED: phospholipase A2, membrane associated isoform X1 [Cricetulus griseus]