Gene/Proteome Database (LMPD)
LMPD ID
LMP001272
Gene ID
Species
Homo sapiens (Human)
Gene Name
hydroxyprostaglandin dehydrogenase 15-(NAD)
Gene Symbol
Synonyms
15-PGDH; PGDH; PGDH1; PHOAR1; SDR36C1
Alternate Names
15-hydroxyprostaglandin dehydrogenase [NAD(+)]; prostaglandin dehydrogenase 1; NAD+-dependent 15-hydroxyprostaglandin dehydrogenase; short chain dehydrogenase/reductase family 36C, member 1
Chromosome
4
Map Location
4q34-q35
EC Number
1.1.1.141
Summary
This gene encodes a member of the short-chain nonmetalloenzyme alcohol dehydrogenase protein family. The encoded enzyme is responsible for the metabolism of prostaglandins, which function in a variety of physiologic and cellular processes such as inflammation. Mutations in this gene result in primary autosomal recessive hypertrophic osteoarthropathy and cranioosteoarthropathy. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2009]
Orthologs
Proteins
| 15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform 1 | |
|---|---|
| Refseq ID | NP_000851 |
| Protein GI | 31542939 |
| UniProt ID | P15428 |
| mRNA ID | NM_000860 |
| Length | 266 |
| RefSeq Status | REVIEWED |
| MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGIHFQDYDTTPFQAKTQ | |
| 15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform 2 | |
|---|---|
| Refseq ID | NP_001139288 |
| Protein GI | 224922801 |
| UniProt ID | P15428 |
| mRNA ID | NM_001145816 |
| Length | 178 |
| RefSeq Status | REVIEWED |
| MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAAPTIDCQWIDNTH | |
| 15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform 3 | |
|---|---|
| Refseq ID | NP_001243230 |
| Protein GI | 372626410 |
| UniProt ID | P15428 |
| mRNA ID | NM_001256301 |
| Length | 145 |
| RefSeq Status | REVIEWED |
| MSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGIHFQDYDTTPFQAKTQ | |
| 15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform 3 | |
|---|---|
| Refseq ID | NP_001243236 |
| Protein GI | 372626423 |
| UniProt ID | P15428 |
| mRNA ID | NM_001256307 |
| Length | 145 |
| RefSeq Status | REVIEWED |
| Protein sequence is identical to GI:372626410 (mRNA isoform) | |
| 15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform 4 | |
|---|---|
| Refseq ID | NP_001243234 |
| Protein GI | 372626421 |
| UniProt ID | P15428 |
| mRNA ID | NM_001256305 |
| Length | 143 |
| RefSeq Status | REVIEWED |
| MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAAHH | |
| 15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform 5 | |
|---|---|
| Refseq ID | NP_001243235 |
| Protein GI | 372626419 |
| UniProt ID | P15428 |
| mRNA ID | NM_001256306 |
| Length | 198 |
| RefSeq Status | REVIEWED |
| MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQLRGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGIHFQDYDTTPFQAKTQ | |
Gene Information
Entrez Gene ID
Gene Name
hydroxyprostaglandin dehydrogenase 15-(NAD)
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016323 | IEA:Ensembl | C | basolateral plasma membrane |
| GO:0005829 | NAS:UniProtKB | C | cytosol |
| GO:0070062 | IDA:UniProt | C | extracellular vesicular exosome |
| GO:0016404 | IDA:UniProtKB | F | 15-hydroxyprostaglandin dehydrogenase (NAD+) activity |
| GO:0051287 | IDA:UniProtKB | F | NAD binding |
| GO:0070403 | IDA:UniProtKB | F | NAD+ binding |
| GO:0003824 | IDA:UniProtKB | F | catalytic activity |
| GO:0004957 | IDA:UniProtKB | F | prostaglandin E receptor activity |
| GO:0042803 | TAS:UniProtKB | F | protein homodimerization activity |
| GO:0019369 | TAS:Reactome | P | arachidonic acid metabolic process |
| GO:0019371 | TAS:Reactome | P | cyclooxygenase pathway |
| GO:0097070 | ISS:UniProtKB | P | ductus arteriosus closure |
| GO:0007565 | IDA:UniProtKB | P | female pregnancy |
| GO:2001300 | TAS:Reactome | P | lipoxin metabolic process |
| GO:0019372 | TAS:UniProtKB | P | lipoxygenase pathway |
| GO:0045786 | IDA:UniProtKB | P | negative regulation of cell cycle |
| GO:0030728 | ISS:UniProtKB | P | ovulation |
| GO:0007567 | IDA:UniProtKB | P | parturition |
| GO:0006693 | IDA:UniProtKB | P | prostaglandin metabolic process |
| GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
| GO:0070493 | ISS:UniProtKB | P | thrombin receptor signaling pathway |
| GO:0007179 | IDA:UniProtKB | P | transforming growth factor beta receptor signaling pathway |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| hsa05202 | Transcriptional misregulation in cancer |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_150320 | Synthesis of Lipoxins (LX) |
| REACT_150149 | Synthesis of Prostaglandins (PG) and Thromboxanes (TX) |
Domain Information
UniProt Annotations
Entry Information
Gene Name
hydroxyprostaglandin dehydrogenase 15-(NAD)
Protein Entry
PGDH_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=5; Name=1; IsoId=P15428-1; Sequence=Displayed; Name=2; IsoId=P15428-2; Sequence=VSP_043032; Name=3; IsoId=P15428-3; Sequence=VSP_045106; Name=4; IsoId=P15428-4; Sequence=VSP_045107, VSP_045108; Name=5; IsoId=P15428-5; Sequence=VSP_045579; Note=No experimental confirmation available.; |
| Biophysicochemical Properties | Kinetic parameters: KM=3.4 uM for prostaglandin E2 ; KM=38 uM for NAD ; |
| Catalytic Activity | (5Z,13E,15S)-11-alpha,15-dihydroxy-9-oxoprost- 5,13-dienoate + NAD(+) = (5Z,13E)-11-alpha-hydroxy-9,15- dioxoprost-5,13-dienoate + NADH. |
| Disease | Cranioosteoarthropathy (COA) [MIM |
| Disease | Hypertrophic osteoarthropathy, primary, autosomal recessive, 1 (PHOAR1) [MIM |
| Disease | Isolated congenital nail clubbing (ICNC) [MIM |
| Function | Prostaglandin inactivation. Contributes to the regulation of events that are under the control of prostaglandin levels. Catalyzes the NAD-dependent dehydrogenation of lipoxin A4 to form 15-oxo-lipoxin A4. Inhibits in vivo proliferation of colon cancer cells. {ECO |
| Induction | Down-regulated by cortisol, dexamethasone and betamethasone. Down-regulated in colon cancer. Up-regulated by TGFB1. |
| Similarity | Belongs to the short-chain dehydrogenases/reductases (SDR) family. |
| Subcellular Location | Cytoplasm. |
| Subunit | Homodimer. |
| Tissue Specificity | Detected in colon epithelium (at protein level). |
| Web Resource | Name=SeattleSNPs; URL="http://pga.gs.washington.edu/data/hpgd/"; |
Identical and Related Proteins
Unique RefSeq proteins for LMP001272 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 31542939 | RefSeq | NP_000851 | 266 | 15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform 1 |
| 224922801 | RefSeq | NP_001139288 | 178 | 15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform 2 |
| 372626410 | RefSeq | NP_001243230 | 145 | 15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform 3 |
| 372626421 | RefSeq | NP_001243234 | 143 | 15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform 4 |
| 372626419 | RefSeq | NP_001243235 | 198 | 15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform 5 |
Identical Sequences to LMP001272 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:224922801 | DBBJ | BAG62569.1 | 178 | unnamed protein product [Homo sapiens] |
| GI:372626410 | DBBJ | BAH12408.1 | 145 | unnamed protein product [Homo sapiens] |
| GI:224922801 | EMBL | CAH91458.1 | 178 | hypothetical protein [Pongo abelii] |
| GI:372626421 | GenBank | AAB53034.1 | 143 | 15-hydroxyprostaglandin dehydrogenase [Homo sapiens] |
| GI:372626421 | GenBank | EAX04735.1 | 143 | hydroxyprostaglandin dehydrogenase 15-(NAD), isoform CRA_b [Homo sapiens] |
| GI:224922801 | GenBank | EAX04737.1 | 178 | hydroxyprostaglandin dehydrogenase 15-(NAD), isoform CRA_c [Homo sapiens] |
| GI:31542939 | GenBank | AGD01470.1 | 266 | Sequence 993 from patent US 8338124 |
| GI:31542939 | GenBank | AHD76715.1 | 266 | Sequence 20935 from patent US 8586006 |
| GI:31542939 | GenBank | AIC48975.1 | 266 | HPGD, partial [synthetic construct] |
| GI:224922801 | RefSeq | NP_001125858.1 | 178 | 15-hydroxyprostaglandin dehydrogenase [NAD(+)] [Pongo abelii] |
| GI:372626410 | RefSeq | NP_001243236.1 | 145 | 15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform 3 [Homo sapiens] |
| GI:31542939 | RefSeq | XP_004040694.1 | 266 | PREDICTED: 15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform 1 [Gorilla gorilla gorilla] |
| GI:224922801 | RefSeq | XP_004040695.1 | 178 | PREDICTED: 15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform 2 [Gorilla gorilla gorilla] |
| GI:372626410 | RefSeq | XP_004040696.1 | 145 | PREDICTED: 15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform 3 [Gorilla gorilla gorilla] |
| GI:372626419 | RefSeq | XP_004040697.1 | 198 | PREDICTED: 15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform 4 [Gorilla gorilla gorilla] |
| GI:372626421 | RefSeq | XP_004040698.1 | 143 | PREDICTED: 15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform 5 [Gorilla gorilla gorilla] |
| GI:372626410 | RefSeq | XP_004040699.1 | 145 | PREDICTED: 15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform 6 [Gorilla gorilla gorilla] |
| GI:31542939 | RefSeq | XP_009238735.1 | 266 | PREDICTED: 15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform X1 [Pongo abelii] |
| GI:372626419 | RefSeq | XP_009238736.1 | 198 | PREDICTED: 15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform X2 [Pongo abelii] |
| GI:372626410 | RefSeq | XP_009238737.1 | 145 | PREDICTED: 15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform X3 [Pongo abelii] |
| GI:372626410 | RefSeq | XP_009238738.1 | 145 | PREDICTED: 15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform X3 [Pongo abelii] |
| GI:372626421 | RefSeq | XP_009238739.1 | 143 | PREDICTED: 15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform X4 [Pongo abelii] |
| GI:31542939 | RefSeq | XP_010358396.1 | 266 | PREDICTED: 15-hydroxyprostaglandin dehydrogenase [NAD(+)] [Rhinopithecus roxellana] |
Related Sequences to LMP001272 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:372626421 | DBBJ | BAG62569.1 | 178 | unnamed protein product [Homo sapiens] |
| GI:372626419 | DBBJ | BAG61916.1 | 198 | unnamed protein product [Homo sapiens] |
| GI:224922801 | EMBL | CAA57843.1 | 178 | 15-hydroxy prostaglandin dehydrogenase [Homo sapiens] |
| GI:31542939 | EMBL | CAD19065.1 | 266 | unnamed protein product [Homo sapiens] |
| GI:372626410 | EMBL | CAD19065.1 | 266 | unnamed protein product [Homo sapiens] |
| GI:372626410 | GenBank | AAA89174.1 | 266 | NAD+-dependent 15-hydroxyprostaglandin dehydrogenase [Homo sapiens] |
| GI:31542939 | GenBank | AAA89174.1 | 266 | NAD+-dependent 15-hydroxyprostaglandin dehydrogenase [Homo sapiens] |
| GI:31542939 | GenBank | AAA89175.1 | 266 | NAD+-dependent 15-hydroxyprostaglandin dehydrogenase [Homo sapiens] |
| GI:372626410 | GenBank | AAA89175.1 | 266 | NAD+-dependent 15-hydroxyprostaglandin dehydrogenase [Homo sapiens] |
| GI:372626421 | GenBank | EAX04737.1 | 178 | hydroxyprostaglandin dehydrogenase 15-(NAD), isoform CRA_c [Homo sapiens] |
| GI:372626410 | GenBank | ADL88137.1 | 266 | Sequence 218 from patent US 7705120 |
| GI:31542939 | GenBank | ADL88137.1 | 266 | Sequence 218 from patent US 7705120 |
| GI:372626421 | RefSeq | NP_001139288.1 | 178 | 15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform 2 [Homo sapiens] |
| GI:224922801 | RefSeq | XP_003258037.1 | 178 | PREDICTED: 15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform 2 [Nomascus leucogenys] |
| GI:31542939 | RefSeq | XP_003823475.1 | 266 | PREDICTED: 15-hydroxyprostaglandin dehydrogenase [NAD(+)] [Pan paniscus] |
| GI:31542939 | RefSeq | XP_003899423.1 | 266 | PREDICTED: 15-hydroxyprostaglandin dehydrogenase [NAD(+)] [Papio anubis] |
| GI:372626421 | RefSeq | XP_004040695.1 | 178 | PREDICTED: 15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform 2 [Gorilla gorilla gorilla] |
| GI:372626421 | RefSeq | XP_004088610.1 | 143 | PREDICTED: 15-hydroxyprostaglandin dehydrogenase [NAD(+)] [Nomascus leucogenys] |
| GI:372626419 | RefSeq | XP_004088611.1 | 198 | PREDICTED: 15-hydroxyprostaglandin dehydrogenase [NAD(+)] [Nomascus leucogenys] |
| GI:372626419 | RefSeq | XP_004433558.1 | 198 | PREDICTED: 15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform 2 [Ceratotherium simum simum] |
| GI:372626421 | RefSeq | XP_004579093.1 | 143 | PREDICTED: 15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform X2 [Ochotona princeps] |
| GI:372626419 | RefSeq | XP_004766146.1 | 198 | PREDICTED: 15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform X2 [Mustela putorius furo] |
| GI:372626419 | RefSeq | XP_004825150.1 | 198 | PREDICTED: 15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform X2 [Mustela putorius furo] |
| GI:224922801 | RefSeq | XP_005209869.1 | 180 | PREDICTED: 15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform X2 [Bos taurus] |
| GI:372626419 | RefSeq | XP_005556383.1 | 198 | PREDICTED: 15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform X2 [Macaca fascicularis] |
| GI:224922801 | RefSeq | XP_005556384.1 | 178 | PREDICTED: 15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform X3 [Macaca fascicularis] |
| GI:224922801 | RefSeq | XP_005892244.1 | 180 | PREDICTED: 15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform X2 [Bos mutus] |
| GI:224922801 | RefSeq | XP_006056338.1 | 178 | PREDICTED: 15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform X3 [Bubalus bubalis] |
| GI:372626410 | RefSeq | XP_009238735.1 | 266 | PREDICTED: 15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform X1 [Pongo abelii] |
| GI:372626410 | RefSeq | XP_010358396.1 | 266 | PREDICTED: 15-hydroxyprostaglandin dehydrogenase [NAD(+)] [Rhinopithecus roxellana] |