Gene/Proteome Database (LMPD)

LMPD ID
LMP001261
Gene ID
91012
Species
Homo sapiens (Human)
Gene Name
ceramide synthase 5
Gene Symbol
CERS5
Synonyms
LASS5; Trh4
Alternate Names
ceramide synthase 5; LAG1 homolog, ceramide synthase 5; LAG1 longevity assurance homolog 5
Chromosome
12
Map Location
12q13.12
EC Number
2.3.1.24
Summary
This gene encodes a protein that belongs to the TLC (TRAM, LAG1 and CLN8 homology domains) family of proteins. The encoded protein functions in the synthesis of ceramide, a lipid molecule that is involved in a several cellular signaling pathways. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013]
Orthologs
View orthologs and multiple alignments for CERS5

Proteins

ceramide synthase 5 isoform 1
Refseq ID NP_671723
Protein GI 22218345
UniProt ID Q8N5B7
mRNA ID NM_147190
Length 392
RefSeq Status REVIEWED
MATAAQGPLSLLWGWLWSERFWLPENVSWADLEGPADGYGYPRGRHILSVFPLAAGIFFVRLLFERFIAKPCALCIGIEDSGPYQAQPNAILEKVFISITKYPDKKRLEGLSKQLDWNVRKIQCWFRHRRNQDKPPTLTKFCESMWRFTFYLCIFCYGIRFLWSSPWFWDIRQCWHNYPFQPLSSGLYHYYIMELAFYWSLMFSQFTDIKRKDFLIMFVHHLVTIGLISFSYINNMVRVGTLIMCLHDVSDFLLEAAKLANYAKYQRLCDTLFVIFSAVFMVTRLGIYPFWILNTTLFESWEIIGPYASWWLLNGLLLTLQLLHVIWSYLIARIALKALIRGKVSKDDRSDVESSSEEEDVTTCTKSPCDSSSSNGANRVNGHMGGSYWAEE
ceramide synthase 5 isoform 2
Refseq ID NP_001268660
Protein GI 528881078
UniProt ID Q8N5B7
mRNA ID NM_001281731
Length 334
RefSeq Status REVIEWED
MMKPRPKRFIAKPCALCIGIEDSGPYQAQPNAILEKVFISITKYPDKKRLEGLSKQLDWNVRKIQCWFRHRRNQDKPPTLTKFCESMWRFTFYLCIFCYGIRFLWSSPWFWDIRQCWHNYPFQPLSSGLYHYYIMELAFYWSLMFSQFTDIKRKDFLIMFVHHLVTIGLISFSYINNMVRVGTLIMCLHDVSDFLLEAAKLANYAKYQRLCDTLFVIFSAVFMVTRLGIYPFWILNTTLFESWEIIGPYASWWLLNGLLLTLQLLHVIWSYLIARIALKALIRGKVSKDDRSDVESSSEEEDVTTCTKSPCDSSSSNGANRVNGHMGGSYWAEE

Gene Information

Entrez Gene ID
91012
Gene Name
ceramide synthase 5
Gene Symbol
CERS5
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005789 TAS:Reactome C endoplasmic reticulum membrane
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005634 IEA:UniProtKB-KW C nucleus
GO:0003677 IEA:UniProtKB-KW F DNA binding
GO:0050291 IDA:HGNC F sphingosine N-acyltransferase activity
GO:0046513 IDA:HGNC P ceramide biosynthetic process
GO:0044281 TAS:Reactome P small molecule metabolic process
GO:0030148 TAS:Reactome P sphingolipid biosynthetic process
GO:0006665 TAS:Reactome P sphingolipid metabolic process

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_115810 Sphingolipid de novo biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR001356 Homeobox domain
IPR009057 Homeodomain-like
IPR016439 Longevity assurance, LAG1/LAC1
IPR006634 TRAM/LAG1/CLN8 homology domain

UniProt Annotations

Entry Information

Gene Name
ceramide synthase 5
Protein Entry
CERS5_HUMAN
UniProt ID
Q8N5B7
Species
Human

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q8N5B7-1; Sequence=Displayed; Name=2; IsoId=Q8N5B7-2; Sequence=VSP_054572; Note=No experimental confirmation available.;
Catalytic Activity Acyl-CoA + sphingosine = CoA + N- acylsphingosine.
Function Dihydroceramide synthase. Catalyzes the acylation of sphingosine to form dihydroceramide, with high selectivity toward palmitoyl-CoA as acyl donor compared to stearoyl-CoA. Inhibited by fumonisin B1 (By similarity).
Pathway Lipid metabolism; sphingolipid metabolism.
Similarity Contains 1 TLC (TRAM/LAG1/CLN8) domain.
Similarity Contains 1 homeobox DNA-binding domain.
Subcellular Location Nucleus membrane {ECO

Identical and Related Proteins

Unique RefSeq proteins for LMP001261 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
22218345 RefSeq NP_671723 392 ceramide synthase 5 isoform 1
528881078 RefSeq NP_001268660 334 ceramide synthase 5 isoform 2

Identical Sequences to LMP001261 proteins

Reference Database Accession Length Protein Name
GI:528881078 DBBJ BAG62566.1 334 unnamed protein product [Homo sapiens]
GI:22218345 EMBL CAH05418.1 392 unnamed protein product [Homo sapiens]
GI:22218345 GenBank AAH32565.1 392 LAG1 homolog, ceramide synthase 5 [Homo sapiens]
GI:22218345 GenBank EAW58132.1 392 LAG1 longevity assurance homolog 5 (S. cerevisiae), isoform CRA_b [Homo sapiens]
GI:528881078 GenBank EAW58133.1 334 LAG1 longevity assurance homolog 5 (S. cerevisiae), isoform CRA_c [Homo sapiens]
GI:22218345 GenBank AGM77115.1 392 Sequence 3 from patent US 8426140
GI:22218345 GenBank AHD70931.1 392 Sequence 4399 from patent US 8586006
GI:22218345 SwissProt Q8N5B7.1 392 RecName: Full=Ceramide synthase 5; Short=CerS5; AltName: Full=LAG1 longevity assurance homolog 5 [Homo sapiens]

Related Sequences to LMP001261 proteins

Reference Database Accession Length Protein Name
GI:22218345 DBBJ BAI45643.1 392 LAG1 homolog, ceramide synthase 5, partial [synthetic construct]
GI:528881078 GenBank EAW58132.1 392 LAG1 longevity assurance homolog 5 (S. cerevisiae), isoform CRA_b [Homo sapiens]
GI:22218345 GenBank EHH20723.1 392 LAG1 longevity assurance-like protein 5 [Macaca mulatta]
GI:22218345 GenBank EHH66273.1 392 LAG1 longevity assurance-like protein 5 [Macaca fascicularis]
GI:22218345 GenBank AFE80777.1 392 LAG1 longevity assurance homolog 5 [Macaca mulatta]
GI:528881078 GenBank AGM77115.1 392 Sequence 3 from patent US 8426140
GI:528881078 RefSeq NP_671723.1 392 ceramide synthase 5 isoform 1 [Homo sapiens]
GI:528881078 RefSeq XP_004053232.1 375 PREDICTED: ceramide synthase 5 [Gorilla gorilla gorilla]
GI:22218345 RefSeq XP_005570878.1 452 PREDICTED: ceramide synthase 5 isoform X3 [Macaca fascicularis]
GI:528881078 RefSeq XP_005570879.1 334 PREDICTED: ceramide synthase 5 isoform X4 [Macaca fascicularis]
GI:22218345 RefSeq XP_008001404.1 452 PREDICTED: ceramide synthase 5 isoform X1 [Chlorocebus sabaeus]
GI:528881078 RefSeq XP_009423703.1 399 PREDICTED: ceramide synthase 5 [Pan troglodytes]