Gene/Proteome Database (LMPD)

LMPD ID
LMP001213
Gene ID
339
Species
Homo sapiens (Human)
Gene Name
apolipoprotein B mRNA editing enzyme, catalytic polypeptide 1
Gene Symbol
Synonyms
APOBEC-1; BEDP; CDAR1; HEPR
Alternate Names
C->U-editing enzyme APOBEC-1; apolipoprotein B mRNA-editing enzyme 1; apolipoprotein B mRNA editing enzyme complex-1
Chromosome
12
Map Location
12p13.1
EC Number
3.5.4.-
Summary
This gene encodes a member of the cytidine deaminase enzyme family. The encoded protein forms a multiple-protein editing holoenzyme with APOBEC1 complementation factor (ACF) and APOBEC1 stimulating protein (ASP). This holoenzyme is involved in the editing of C-to-U nucleotide bases in apolipoprotein B and neurofibromatosis-1 mRNAs. [provided by RefSeq, Jul 2008]
Orthologs

Proteins

C->U-editing enzyme APOBEC-1
Refseq ID NP_001635
Protein GI 61743957
UniProt ID P41238
mRNA ID NM_001644
Length 236
RefSeq Status REVIEWED
MTSEKGPSTGDPTLRRRIEPWEFDVFYDPRELRKEACLLYEIKWGMSRKIWRSSGKNTTNHVEVNFIKKFTSERDFHPSMSCSITWFLSWSPCWECSQAIREFLSRHPGVTLVIYVARLFWHMDQQNRQGLRDLVNSGVTIQIMRASEYYHCWRNFVNYPPGDEAHWPQYPPLWMMLYALELHCIILSLPPCLKISRRWQNHLTFFRLHLQNCHYQTIPPHILLATGLIHPSVAWR

Gene Information

Entrez Gene ID
339
Gene Name
apolipoprotein B mRNA editing enzyme, catalytic polypeptide 1
Gene Symbol
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 IDA:UniProtKB C cytoplasm
GO:0005654 TAS:Reactome C nucleoplasm
GO:0017091 IEA:Ensembl F AU-rich element binding
GO:0003723 TAS:ProtInc F RNA binding
GO:0004126 TAS:ProtInc F cytidine deaminase activity
GO:0008270 TAS:ProtInc F zinc ion binding
GO:0080111 ISS:UniProtKB P DNA demethylation
GO:0006396 TAS:ProtInc P RNA processing
GO:0032869 IEA:Ensembl P cellular response to insulin stimulus
GO:0009972 TAS:GOC P cytidine deamination
GO:0016554 TAS:Reactome P cytidine to uridine editing
GO:0051607 IEA:Ensembl P defense response to virus
GO:0010467 TAS:Reactome P gene expression
GO:0006629 TAS:ProtInc P lipid metabolic process
GO:0042158 IEA:Ensembl P lipoprotein biosynthetic process
GO:0042953 IEA:Ensembl P lipoprotein transport
GO:0016556 TAS:Reactome P mRNA modification
GO:0006397 IEA:UniProtKB-KW P mRNA processing
GO:0048255 IEA:Ensembl P mRNA stabilization
GO:0090310 ISS:UniProtKB P negative regulation of methylation-dependent chromatin silencing
GO:0042127 IEA:Ensembl P regulation of cell proliferation
GO:0051592 IEA:Ensembl P response to calcium ion
GO:0042493 IEA:Ensembl P response to drug
GO:0045471 IEA:Ensembl P response to ethanol
GO:0010332 IEA:Ensembl P response to gamma radiation
GO:0006970 IEA:Ensembl P response to osmotic stress
GO:0010043 IEA:Ensembl P response to zinc ion

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_1390 Formation of the Editosome
REACT_71 Gene Expression
REACT_1757 mRNA Editing
REACT_167 mRNA Editing: C to U Conversion

Domain Information

InterPro Annotations

Accession Description
IPR013158 APOBEC-like, N-terminal
IPR016192 APOBEC/CMP deaminase, zinc-binding
IPR016193 Cytidine_deaminase-like

UniProt Annotations

Entry Information

Gene Name
apolipoprotein B mRNA editing enzyme, catalytic polypeptide 1
Protein Entry
ABEC1_HUMAN
UniProt ID
Species
Human

Comments

Comment Type Description
Cofactor Name=Zn(2+); Xref=ChEBI
Function Catalytic component of the apolipoprotein B mRNA editing enzyme complex which is responsible for the postranscriptional editing of a CAA codon for Gln to a UAA codon for stop in the APOB mRNA. Also involved in CGA (Arg) to UGA (Stop) editing in the NF1 mRNA. May also play a role in the epigenetic regulation of gene expression by participating in DNA demethylation.
Similarity Belongs to the cytidine and deoxycytidylate deaminase family.
Subcellular Location Cytoplasm .
Subunit Homodimer. Part of the apolipoprotein B mRNA editing complex with A1CF. Found in a complex with CELF2/CUGBP2 and A1CF. Interacts with HNRPAB and SYNCRIP. {ECO
Tissue Specificity Expressed exclusively in the small intestine.

Identical and Related Proteins

Unique RefSeq proteins for LMP001213 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
61743957 RefSeq NP_001635 236 C->U-editing enzyme APOBEC-1

Identical Sequences to LMP001213 proteins

Reference Database Accession Length Protein Name
GI:61743957 GenBank AAD00185.1 236 apolipoprotein B mRNA editing enzyme complex-1 [Homo sapiens]
GI:61743957 GenBank AAI72305.1 236 Apolipoprotein B mRNA editing enzyme, catalytic polypeptide 1 [synthetic construct]
GI:61743957 GenBank AHE02192.1 236 Sequence 60546 from patent US 8586006
GI:61743957 RefSeq XP_005253412.1 236 PREDICTED: C->U-editing enzyme APOBEC-1 isoform X1 [Homo sapiens]
GI:61743957 SwissProt P41238.3 236 RecName: Full=C->U-editing enzyme APOBEC-1; AltName: Full=Apolipoprotein B mRNA-editing enzyme 1; AltName: Full=HEPR [Homo sapiens]

Related Sequences to LMP001213 proteins

Reference Database Accession Length Protein Name
GI:61743957 DBBJ BAA23882.1 236 apobec-1 [Homo sapiens]
GI:61743957 GenBank AAA64230.1 236 apolipoprotein B mRNA editing enzyme, catalytic polypeptide 1 [Homo sapiens]
GI:61743957 GenBank AAA86766.1 236 apolipoprotein B mRNA editing protein [Homo sapiens]
GI:61743957 GenBank AAE07920.1 236 Sequence 4 from patent US 5804185
GI:61743957 GenBank AAE45502.1 236 Sequence 4 from patent US 6087108
GI:61743957 pat US 236 Sequence 4 from patent US 5747319