Gene/Proteome Database (LMPD)
LMPD ID
LMP001213
Gene ID
Species
Homo sapiens (Human)
Gene Name
apolipoprotein B mRNA editing enzyme, catalytic polypeptide 1
Gene Symbol
Synonyms
APOBEC-1; BEDP; CDAR1; HEPR
Alternate Names
C->U-editing enzyme APOBEC-1; apolipoprotein B mRNA-editing enzyme 1; apolipoprotein B mRNA editing enzyme complex-1
Chromosome
12
Map Location
12p13.1
EC Number
3.5.4.-
Summary
This gene encodes a member of the cytidine deaminase enzyme family. The encoded protein forms a multiple-protein editing holoenzyme with APOBEC1 complementation factor (ACF) and APOBEC1 stimulating protein (ASP). This holoenzyme is involved in the editing of C-to-U nucleotide bases in apolipoprotein B and neurofibromatosis-1 mRNAs. [provided by RefSeq, Jul 2008]
Orthologs
Proteins
| C->U-editing enzyme APOBEC-1 | |
|---|---|
| Refseq ID | NP_001635 |
| Protein GI | 61743957 |
| UniProt ID | P41238 |
| mRNA ID | NM_001644 |
| Length | 236 |
| RefSeq Status | REVIEWED |
| MTSEKGPSTGDPTLRRRIEPWEFDVFYDPRELRKEACLLYEIKWGMSRKIWRSSGKNTTNHVEVNFIKKFTSERDFHPSMSCSITWFLSWSPCWECSQAIREFLSRHPGVTLVIYVARLFWHMDQQNRQGLRDLVNSGVTIQIMRASEYYHCWRNFVNYPPGDEAHWPQYPPLWMMLYALELHCIILSLPPCLKISRRWQNHLTFFRLHLQNCHYQTIPPHILLATGLIHPSVAWR | |
Gene Information
Entrez Gene ID
Gene Name
apolipoprotein B mRNA editing enzyme, catalytic polypeptide 1
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005737 | IDA:UniProtKB | C | cytoplasm |
| GO:0005654 | TAS:Reactome | C | nucleoplasm |
| GO:0017091 | IEA:Ensembl | F | AU-rich element binding |
| GO:0003723 | TAS:ProtInc | F | RNA binding |
| GO:0004126 | TAS:ProtInc | F | cytidine deaminase activity |
| GO:0008270 | TAS:ProtInc | F | zinc ion binding |
| GO:0080111 | ISS:UniProtKB | P | DNA demethylation |
| GO:0006396 | TAS:ProtInc | P | RNA processing |
| GO:0032869 | IEA:Ensembl | P | cellular response to insulin stimulus |
| GO:0009972 | TAS:GOC | P | cytidine deamination |
| GO:0016554 | TAS:Reactome | P | cytidine to uridine editing |
| GO:0051607 | IEA:Ensembl | P | defense response to virus |
| GO:0010467 | TAS:Reactome | P | gene expression |
| GO:0006629 | TAS:ProtInc | P | lipid metabolic process |
| GO:0042158 | IEA:Ensembl | P | lipoprotein biosynthetic process |
| GO:0042953 | IEA:Ensembl | P | lipoprotein transport |
| GO:0016556 | TAS:Reactome | P | mRNA modification |
| GO:0006397 | IEA:UniProtKB-KW | P | mRNA processing |
| GO:0048255 | IEA:Ensembl | P | mRNA stabilization |
| GO:0090310 | ISS:UniProtKB | P | negative regulation of methylation-dependent chromatin silencing |
| GO:0042127 | IEA:Ensembl | P | regulation of cell proliferation |
| GO:0051592 | IEA:Ensembl | P | response to calcium ion |
| GO:0042493 | IEA:Ensembl | P | response to drug |
| GO:0045471 | IEA:Ensembl | P | response to ethanol |
| GO:0010332 | IEA:Ensembl | P | response to gamma radiation |
| GO:0006970 | IEA:Ensembl | P | response to osmotic stress |
| GO:0010043 | IEA:Ensembl | P | response to zinc ion |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_1390 | Formation of the Editosome |
| REACT_71 | Gene Expression |
| REACT_1757 | mRNA Editing |
| REACT_167 | mRNA Editing: C to U Conversion |
Domain Information
UniProt Annotations
Entry Information
Gene Name
apolipoprotein B mRNA editing enzyme, catalytic polypeptide 1
Protein Entry
ABEC1_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Cofactor | Name=Zn(2+); Xref=ChEBI |
| Function | Catalytic component of the apolipoprotein B mRNA editing enzyme complex which is responsible for the postranscriptional editing of a CAA codon for Gln to a UAA codon for stop in the APOB mRNA. Also involved in CGA (Arg) to UGA (Stop) editing in the NF1 mRNA. May also play a role in the epigenetic regulation of gene expression by participating in DNA demethylation. |
| Similarity | Belongs to the cytidine and deoxycytidylate deaminase family. |
| Subcellular Location | Cytoplasm . |
| Subunit | Homodimer. Part of the apolipoprotein B mRNA editing complex with A1CF. Found in a complex with CELF2/CUGBP2 and A1CF. Interacts with HNRPAB and SYNCRIP. {ECO |
| Tissue Specificity | Expressed exclusively in the small intestine. |
Identical and Related Proteins
Unique RefSeq proteins for LMP001213 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 61743957 | RefSeq | NP_001635 | 236 | C->U-editing enzyme APOBEC-1 |
Identical Sequences to LMP001213 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:61743957 | GenBank | AAD00185.1 | 236 | apolipoprotein B mRNA editing enzyme complex-1 [Homo sapiens] |
| GI:61743957 | GenBank | AAI72305.1 | 236 | Apolipoprotein B mRNA editing enzyme, catalytic polypeptide 1 [synthetic construct] |
| GI:61743957 | GenBank | AHE02192.1 | 236 | Sequence 60546 from patent US 8586006 |
| GI:61743957 | RefSeq | XP_005253412.1 | 236 | PREDICTED: C->U-editing enzyme APOBEC-1 isoform X1 [Homo sapiens] |
| GI:61743957 | SwissProt | P41238.3 | 236 | RecName: Full=C->U-editing enzyme APOBEC-1; AltName: Full=Apolipoprotein B mRNA-editing enzyme 1; AltName: Full=HEPR [Homo sapiens] |
Related Sequences to LMP001213 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:61743957 | DBBJ | BAA23882.1 | 236 | apobec-1 [Homo sapiens] |
| GI:61743957 | GenBank | AAA64230.1 | 236 | apolipoprotein B mRNA editing enzyme, catalytic polypeptide 1 [Homo sapiens] |
| GI:61743957 | GenBank | AAA86766.1 | 236 | apolipoprotein B mRNA editing protein [Homo sapiens] |
| GI:61743957 | GenBank | AAE07920.1 | 236 | Sequence 4 from patent US 5804185 |
| GI:61743957 | GenBank | AAE45502.1 | 236 | Sequence 4 from patent US 6087108 |
| GI:61743957 | pat | US | 236 | Sequence 4 from patent US 5747319 |