Gene/Proteome Database (LMPD)

LMPD ID
LMP001119
Gene ID
Species
Mus musculus (Mouse)
Gene Name
degenerative spermatocyte homolog 1 (Drosophila)
Gene Symbol
Synonyms
AA536663; Degs; Des1; Mdes
Alternate Names
sphingolipid delta(4)-desaturase DES1; dihydroceramide desaturase
Chromosome
1
Map Location
1|1 H5
EC Number
1.14.-.-

Proteins

sphingolipid delta(4)-desaturase DES1
Refseq ID NP_031879
Protein GI 6681175
UniProt ID O09005
mRNA ID NM_007853
Length 323
RefSeq Status PROVISIONAL
MGSRVSREEFEWVYTDQPHAARRKEILAKYPEIKSLMKPDHNLIWIVAMMLLVQLASFYLVKDLDWKWVIFWSYVFGSCLNHSMTLAIHEISHNFPFGHHKALWNRWFGMFANLSLGVPYSISFKRYHMDHHRYLGADKIDVDIPTDFEGWFFCTTFRKFVWVILQPLFYAFRPLFINPKPITYLEIINTVIQITFDIIIYYVFGVKSLVYMLAATLLGLGLHPISGHFIAEHYMFLKGHETYSYYGPLNLLTFNVGYHNEHHDFPNVPGKNLPMVRKIASEYYDDLPHYNSWIKVLYDFVTDDTISPYSRMKRPPKGNEILE

Gene Information

Entrez Gene ID
Gene Name
degenerative spermatocyte homolog 1 (Drosophila)
Gene Symbol
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IEA:UniProtKB-KW C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005739 IEA:UniProtKB-KW C mitochondrion
GO:0016705 IEA:InterPro F oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0006633 IEA:UniProtKB-KW P fatty acid biosynthetic process
GO:0030148 IEA:InterPro P sphingolipid biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
mmu00600 Sphingolipid metabolism

REACTOME Pathway Links

REACTOME Pathway ID Description
5893777 Sphingolipid de novo biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR005804 Fatty acid desaturase, type 1
IPR011388 Sphingolipid delta4-desaturase
IPR013866 Sphingolipid delta4-desaturase, N-terminal

UniProt Annotations

Entry Information

Gene Name
degenerative spermatocyte homolog 1 (Drosophila)
Protein Entry
DEGS1_MOUSE
UniProt ID
Species
Mouse

Comments

Comment Type Description
Function Has sphingolipid-delta-4-desaturase activity. Converts D-erythro-sphinganine to D-erythro-sphingosine (E-sphing-4-enine). {ECO:0000269|PubMed:11937514}.
Ptm Myristoylation can target the enzyme to the mitochondria leading to an increase in ceramide levels. {ECO:0000250}.
Similarity Belongs to the fatty acid desaturase family. DEGS subfamily. {ECO:0000305}.
Subcellular Location Mitochondrion. Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}.
Tissue Specificity Detected in testis. Detected in pachytene spermatocytes and round spermatids. {ECO:0000269|PubMed:9227906}.

Identical and Related Proteins

Unique RefSeq proteins for LMP001119 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6681175 RefSeq NP_031879 323 sphingolipid delta(4)-desaturase DES1

Identical Sequences to LMP001119 proteins

Reference Database Accession Length Protein Name
GI:6681175 DBBJ BAB22233.1 323 unnamed protein product [Mus musculus]
GI:6681175 DBBJ BAC36713.1 323 unnamed protein product [Mus musculus]
GI:6681175 DBBJ BAE37337.1 323 unnamed protein product [Mus musculus]
GI:6681175 DBBJ BAE29098.1 323 unnamed protein product [Mus musculus]
GI:6681175 GenBank AAH03751.1 323 Degenerative spermatocyte homolog 1 (Drosophila) [Mus musculus]
GI:6681175 SwissProt O09005.1 323 RecName: Full=Sphingolipid delta(4)-desaturase DES1; AltName: Full=Degenerative spermatocyte homolog 1 [Mus musculus]

Related Sequences to LMP001119 proteins

Reference Database Accession Length Protein Name
GI:6681175 EMBL CAI79416.1 323 rat sphingolipid delta 4 desaturase [Rattus norvegicus]
GI:6681175 GenBank AAK64511.1 323 degenerative spermatocyte-like protein RDES [Rattus norvegicus]
GI:6681175 GenBank AAM12532.1 323 sphingolipid delta 4 desaturase protein DES1 [Mus musculus]
GI:6681175 GenBank AAH83727.1 323 Degs1 protein [Rattus norvegicus]
GI:6681175 RefSeq NP_445775.2 323 sphingolipid delta(4)-desaturase DES1 [Rattus norvegicus]
GI:6681175 SwissProt Q5XIF5.1 323 RecName: Full=Sphingolipid delta(4)-desaturase DES1; AltName: Full=Degenerative spermatocyte homolog 1; AltName: Full=Degenerative spermatocyte-like protein RDES [Rattus norvegicus]