Gene/Proteome Database (LMPD)
Proteins
| apolipoprotein C-II precursor | |
|---|---|
| Refseq ID | NP_001264873 |
| Protein GI | 485050543 |
| UniProt ID | Q05020 |
| mRNA ID | NM_001277944 |
| Length | 97 |
| RefSeq Status | VALIDATED |
| MGSRFFLALFLVILMLGNEVQGNQEDDSGSLALLGTVQGSLLSYWTSAKEVAKDLYQKTYPISMDEKLRDMYSKSSAAMSTYAGIFTDQLLTLLRGE | |
| sig_peptide: 1..22 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2456 peptide sequence: MGSRFFLALFLVILMLGNEVQG mat_peptide: 23..97 product: Apolipoprotein C-II experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q05020.1) calculated_mol_wt: 8303 peptide sequence: NQEDDSGSLALLGTVQGSLLSYWTSAKEVAKDLYQKTYPISMDEKLRDMYSKSSAAMSTYAGIFTDQLLTLLRGE | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0042627 | IEA:UniProtKB-KW | C | chylomicron |
| GO:0005829 | TAS:Reactome | C | cytosol |
| GO:0005576 | TAS:Reactome | C | extracellular region |
| GO:0034361 | IEA:UniProtKB-KW | C | very-low-density lipoprotein particle |
| GO:0008047 | IEA:InterPro | F | enzyme activator activity |
| GO:0016042 | IEA:UniProtKB-KW | P | lipid catabolic process |
| GO:0006869 | IEA:UniProtKB-KW | P | lipid transport |
| GO:0042953 | IEA:Ensembl | P | lipoprotein transport |
| GO:0042493 | IEA:Ensembl | P | response to drug |
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Function | Component of chylomicrons, very low-density lipoproteins (VLDL), low-density lipoproteins (LDL), and high-density lipoproteins (HDL) in plasma. Plays an important role in lipoprotein metabolism as an activator of lipoprotein lipase. {ECO:0000250|UniProtKB:P02655}. |
| Similarity | Belongs to the apolipoprotein C2 family. {ECO:0000305}. |
| Subcellular Location | Secreted {ECO:0000250|UniProtKB:P02655}. |
| Tissue Specificity | Adult and fetal liver, intestine and peritoneal macrophages. {ECO:0000269|PubMed:7691714}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP001115 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 485050543 | RefSeq | NP_001264873 | 97 | apolipoprotein C-II precursor |
Identical Sequences to LMP001115 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:485050543 | DBBJ | BAE27195.1 | 97 | unnamed protein product [Mus musculus] |
| GI:485050543 | EMBL | CAA78804.1 | 97 | Apolipoprotein C2 [Mus musculus] |
| GI:485050543 | GenBank | AAH24697.1 | 97 | Apolipoprotein C-II [Mus musculus] |
| GI:485050543 | GenBank | AAI06109.1 | 97 | Apoc2 protein [Mus musculus] |
| GI:485050543 | GenBank | EDL23171.1 | 97 | apolipoprotein C-II [Mus musculus] |
| GI:485050543 | SwissProt | Q05020.1 | 97 | RecName: Full=Apolipoprotein C-II; Short=Apo-CII; Short=ApoC-II; AltName: Full=Apolipoprotein C2; Flags: Precursor [Mus musculus] |
Related Sequences to LMP001115 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:485050543 | EMBL | CAA80220.1 | 97 | apolipoprotein C2 [Mus musculus] |
| GI:485050543 | GenBank | EDM08174.1 | 97 | apolipoprotein C-II (predicted) [Rattus norvegicus] |
| GI:485050543 | RefSeq | NP_001078821.1 | 97 | apolipoprotein C-II precursor [Rattus norvegicus] |
| GI:485050543 | RefSeq | XP_005086375.1 | 100 | PREDICTED: apolipoprotein C-II [Mesocricetus auratus] |
| GI:485050543 | RefSeq | XP_007607588.1 | 100 | PREDICTED: apolipoprotein C-II isoform X1 [Cricetulus griseus] |
| GI:485050543 | RefSeq | XP_007607589.1 | 97 | PREDICTED: apolipoprotein C-II isoform X2 [Cricetulus griseus] |