Gene/Proteome Database (LMPD)

LMPD ID
LMP001115
Gene ID
Species
Mus musculus (Mouse)
Gene Name
apolipoprotein C-II
Gene Symbol
Synonyms
-
Alternate Names
apolipoprotein C-II; apo-CII; apoC-II; apolipoprotein C2
Chromosome
7
Map Location
7 A3|7 9.94 cM

Proteins

apolipoprotein C-II precursor
Refseq ID NP_001264873
Protein GI 485050543
UniProt ID Q05020
mRNA ID NM_001277944
Length 97
RefSeq Status VALIDATED
MGSRFFLALFLVILMLGNEVQGNQEDDSGSLALLGTVQGSLLSYWTSAKEVAKDLYQKTYPISMDEKLRDMYSKSSAAMSTYAGIFTDQLLTLLRGE
sig_peptide: 1..22 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2456 peptide sequence: MGSRFFLALFLVILMLGNEVQG mat_peptide: 23..97 product: Apolipoprotein C-II experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q05020.1) calculated_mol_wt: 8303 peptide sequence: NQEDDSGSLALLGTVQGSLLSYWTSAKEVAKDLYQKTYPISMDEKLRDMYSKSSAAMSTYAGIFTDQLLTLLRGE

Gene Information

Entrez Gene ID
Gene Name
apolipoprotein C-II
Gene Symbol
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0042627 IEA:UniProtKB-KW C chylomicron
GO:0005829 TAS:Reactome C cytosol
GO:0005576 TAS:Reactome C extracellular region
GO:0034361 IEA:UniProtKB-KW C very-low-density lipoprotein particle
GO:0008047 IEA:InterPro F enzyme activator activity
GO:0016042 IEA:UniProtKB-KW P lipid catabolic process
GO:0006869 IEA:UniProtKB-KW P lipid transport
GO:0042953 IEA:Ensembl P lipoprotein transport
GO:0042493 IEA:Ensembl P response to drug

REACTOME Pathway Links

REACTOME Pathway ID Description
5893389 Chylomicron-mediated lipid transport
5893599 HDL-mediated lipid transport
5893902 Retinoid metabolism and transport

Domain Information

InterPro Annotations

Accession Description
IPR023121 ApoC-II domain
IPR008019 Apolipoprotein C-II

UniProt Annotations

Entry Information

Gene Name
apolipoprotein C-II
Protein Entry
APOC2_MOUSE
UniProt ID
Species
Mouse

Comments

Comment Type Description
Function Component of chylomicrons, very low-density lipoproteins (VLDL), low-density lipoproteins (LDL), and high-density lipoproteins (HDL) in plasma. Plays an important role in lipoprotein metabolism as an activator of lipoprotein lipase. {ECO:0000250|UniProtKB:P02655}.
Similarity Belongs to the apolipoprotein C2 family. {ECO:0000305}.
Subcellular Location Secreted {ECO:0000250|UniProtKB:P02655}.
Tissue Specificity Adult and fetal liver, intestine and peritoneal macrophages. {ECO:0000269|PubMed:7691714}.

Identical and Related Proteins

Unique RefSeq proteins for LMP001115 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
485050543 RefSeq NP_001264873 97 apolipoprotein C-II precursor

Identical Sequences to LMP001115 proteins

Reference Database Accession Length Protein Name
GI:485050543 DBBJ BAE27195.1 97 unnamed protein product [Mus musculus]
GI:485050543 EMBL CAA78804.1 97 Apolipoprotein C2 [Mus musculus]
GI:485050543 GenBank AAH24697.1 97 Apolipoprotein C-II [Mus musculus]
GI:485050543 GenBank AAI06109.1 97 Apoc2 protein [Mus musculus]
GI:485050543 GenBank EDL23171.1 97 apolipoprotein C-II [Mus musculus]
GI:485050543 SwissProt Q05020.1 97 RecName: Full=Apolipoprotein C-II; Short=Apo-CII; Short=ApoC-II; AltName: Full=Apolipoprotein C2; Flags: Precursor [Mus musculus]

Related Sequences to LMP001115 proteins

Reference Database Accession Length Protein Name
GI:485050543 EMBL CAA80220.1 97 apolipoprotein C2 [Mus musculus]
GI:485050543 GenBank EDM08174.1 97 apolipoprotein C-II (predicted) [Rattus norvegicus]
GI:485050543 RefSeq NP_001078821.1 97 apolipoprotein C-II precursor [Rattus norvegicus]
GI:485050543 RefSeq XP_005086375.1 100 PREDICTED: apolipoprotein C-II [Mesocricetus auratus]
GI:485050543 RefSeq XP_007607588.1 100 PREDICTED: apolipoprotein C-II isoform X1 [Cricetulus griseus]
GI:485050543 RefSeq XP_007607589.1 97 PREDICTED: apolipoprotein C-II isoform X2 [Cricetulus griseus]