Gene/Proteome Database (LMPD)

LMPD ID
LMP001092
Gene ID
5051
Species
Homo sapiens (Human)
Gene Name
platelet-activating factor acetylhydrolase 2, 40kDa
Gene Symbol
PAFAH2
Synonyms
HSD-PLA2
Alternate Names
platelet-activating factor acetylhydrolase 2, cytoplasmic; SD-PLA2; serine-dependent phospholipase A2
Chromosome
1
Map Location
1p36
EC Number
3.1.1.47
Summary
This gene encodes platelet-activating factor acetylhydrolase isoform 2, a single-subunit intracellular enzyme that catalyzes the removal of the acetyl group at the SN-2 position of platelet-activating factor (identified as 1-O-alkyl-2-acetyl-sn-glyceryl-3-phosphorylcholine). However, this lipase exhibits a broader substrate specificity than simply platelet activating factor. Two other isoforms of intracellular platelet-activating factor acetylhydrolase exist, and both are multi-subunit enzymes. Additionally, there is a single-subunit serum isoform of this enzyme. [provided by RefSeq, Jul 2008]
Orthologs
View orthologs and multiple alignments for PAFAH2

Proteins

platelet-activating factor acetylhydrolase 2, cytoplasmic
Refseq ID NP_000428
Protein GI 4758878
UniProt ID Q99487
mRNA ID NM_000437
Length 392
RefSeq Status REVIEWED
MGVNQSVGFPPVTGPHLVGCGDVMEGQNLQGSFFRLFYPCQKAEETMEQPLWIPRYEYCTGLAEYLQFNKRCGGLLFNLAVGSCRLPVSWNGPFKTKDSGYPLIIFSHGLGAFRTLYSAFCMELASRGFVVAVPEHRDRSAATTYFCKQAPEENQPTNESLQEEWIPFRRVEEGEKEFHVRNPQVHQRVSECLRVLKILQEVTAGQTVFNILPGGLDLMTLKGNIDMSRVAVMGHSFGGATAILALAKETQFRCAVALDAWMFPLERDFYPKARGPVFFINTEKFQTMESVNLMKKICAQHEQSRIITVLGSVHRSQTDFAFVTGNLIGKFFSTETRGSLDPYEGQEVMVRAMLAFLQKHLDLKEDYNQWNNLIEGIGPSLTPGAPHHLSSL

Gene Information

Entrez Gene ID
5051
Gene Name
platelet-activating factor acetylhydrolase 2, 40kDa
Gene Symbol
PAFAH2
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 IEA:UniProtKB-KW C cytoplasm
GO:0003847 IEA:UniProtKB-EC F 1-alkyl-2-acetylglycerophosphocholine esterase activity
GO:0005543 TAS:ProtInc F phospholipid binding
GO:0016042 IEA:UniProtKB-KW P lipid catabolic process
GO:0006629 TAS:ProtInc P lipid metabolic process
GO:0043066 IEA:Ensembl P negative regulation of apoptotic process

KEGG Pathway Links

KEGG Pathway ID Description
hsa00565 Ether lipid metabolism
ko00565 Ether lipid metabolism
hsa01100 Metabolic pathways

Domain Information

InterPro Annotations

Accession Description
IPR029058 Alpha/Beta hydrolase fold
IPR005065 Platelet-activating factor acetylhydrolase
IPR016715 Platelet-activating factor acetylhydrolase, eucaryote

UniProt Annotations

Entry Information

Gene Name
platelet-activating factor acetylhydrolase 2, 40kDa
Protein Entry
PAFA2_HUMAN
UniProt ID
Q99487
Species
Human

Comments

Comment Type Description
Catalytic Activity 1-alkyl-2-acetyl-sn-glycero-3-phosphocholine + H(2)O = 1-alkyl-sn-glycero-3-phosphocholine + acetate.
Enzyme Regulation Inhibited by phenylmethanesulfonyl fluoride, 3,4,dichloroisocoumarin, diisopropyl fluorophosphate (DFP) and diethyl p-nitrophenyl phosphate (DENP).
Function Has a marked selectivity for phospholipids with short acyl chains at the sn-2 position. May share a common physiologic function with the plasma-type enzyme.
Mass Spectrometry Mass=44162; Method=Electrospray; Range=1-392; Evidence= ;
Similarity Belongs to the serine esterase family.
Subcellular Location Cytoplasm.
Subunit Monomer.
Tissue Specificity Broadly expressed in different tissues, but high in B- and T-lymphocytes. In brain, expression is restricted to amygdala and frontal cortex.

Identical and Related Proteins

Unique RefSeq proteins for LMP001092 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
4758878 RefSeq NP_000428 392 platelet-activating factor acetylhydrolase 2, cytoplasmic

Identical Sequences to LMP001092 proteins

Reference Database Accession Length Protein Name
GI:4758878 GenBank EAX07852.1 392 platelet-activating factor acetylhydrolase 2, 40kDa, isoform CRA_a [Homo sapiens]
GI:4758878 GenBank EAX07853.1 392 platelet-activating factor acetylhydrolase 2, 40kDa, isoform CRA_a [Homo sapiens]
GI:4758878 GenBank ABM83722.1 392 platelet-activating factor acetylhydrolase 2, 40kDa [synthetic construct]
GI:4758878 GenBank ABM87042.1 392 platelet-activating factor acetylhydrolase 2, 40kDa, partial [synthetic construct]
GI:4758878 GenBank AEU43376.1 392 Sequence 125 from patent US 8052970
GI:4758878 RefSeq XP_006710733.1 392 PREDICTED: platelet-activating factor acetylhydrolase 2, cytoplasmic isoform X3 [Homo sapiens]

Related Sequences to LMP001092 proteins

Reference Database Accession Length Protein Name
GI:4758878 DBBJ BAG36551.1 392 unnamed protein product [Homo sapiens]
GI:4758878 GenBank AAC39707.1 392 serine dependent phospholipase [Homo sapiens]
GI:4758878 RefSeq XP_003809510.1 392 PREDICTED: platelet-activating factor acetylhydrolase 2, cytoplasmic [Pan paniscus]
GI:4758878 RefSeq XP_004025262.1 392 PREDICTED: platelet-activating factor acetylhydrolase 2, cytoplasmic [Gorilla gorilla gorilla]
GI:4758878 RefSeq XP_006710731.1 416 PREDICTED: platelet-activating factor acetylhydrolase 2, cytoplasmic isoform X1 [Homo sapiens]
GI:4758878 RefSeq XP_008959936.1 392 PREDICTED: platelet-activating factor acetylhydrolase 2, cytoplasmic [Pan paniscus]