Gene/Proteome Database (LMPD)

LMPD ID
LMP001090
Gene ID
10229
Species
Homo sapiens (Human)
Gene Name
coenzyme Q7 homolog, ubiquinone (yeast)
Gene Symbol
COQ7
Synonyms
CAT5; CLK-1; CLK1
Alternate Names
ubiquinone biosynthesis protein COQ7 homolog; placental protein KG-20; timing protein clk-1 homolog; COQ7 coenzyme Q, 7 homolog ubiquinone; coenzyme Q biosynthesis protein 7 homolog
Chromosome
16
Map Location
16p12.3
Summary
The protein encoded by this gene is similar to a mitochondrial di-iron containing hydroxylase in Saccharomyces cerevisiae that is involved with ubiquinone biosynthesis. Mutations in the yeast gene lead to slower development and longer life span. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2010]
Orthologs
View orthologs and multiple alignments for COQ7

Proteins

ubiquinone biosynthesis protein COQ7 homolog isoform 1
Refseq ID NP_057222
Protein GI 25453484
UniProt ID Q99807
mRNA ID NM_016138
Length 217
RefSeq Status REVIEWED
MSCAGAAAAPRLWRLRPGARRSLSAYGRRTSVRFRSSGMTLDNISRAAVDRIIRVDHAGEYGANRIYAGQMAVLGRTSVGPVIQKMWDQEKDHLKKFNELMVTFRVRPTVLMPLWNVLGFALGAGTALLGKEGAMACTVAVEESIAHHYNNQIRTLMEEDPEKYEELLQLIKKFRDEELEHHDIGLDHDAELAPAYAVLKSIIQAGCRVAIYLSERL
ubiquinone biosynthesis protein COQ7 homolog isoform 2
Refseq ID NP_001177912
Protein GI 300244542
UniProt ID Q99807
mRNA ID NM_001190983
Length 179
RefSeq Status REVIEWED
MTLDNISRAAVDRIIRVDHAGEYGANRIYAGQMAVLGRTSVGPVIQKMWDQEKDHLKKFNELMVTFRVRPTVLMPLWNVLGFALGAGTALLGKEGAMACTVAVEESIAHHYNNQIRTLMEEDPEKYEELLQLIKKFRDEELEHHDIGLDHDAELAPAYAVLKSIIQAGCRVAIYLSERL

Gene Information

Entrez Gene ID
10229
Gene Name
coenzyme Q7 homolog, ubiquinone (yeast)
Gene Symbol
COQ7
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005743 IEA:UniProtKB-KW C mitochondrial inner membrane
GO:0005634 IDA:LIFEdb C nucleus
GO:0046872 IEA:UniProtKB-KW F metal ion binding
GO:0001306 IEA:Ensembl P age-dependent response to oxidative stress
GO:0034599 IEA:Ensembl P cellular response to oxidative stress
GO:0008340 IEA:Ensembl P determination of adult lifespan
GO:0001701 IEA:Ensembl P in utero embryonic development
GO:0042775 IEA:Ensembl P mitochondrial ATP synthesis coupled electron transport
GO:0070584 IEA:Ensembl P mitochondrion morphogenesis
GO:0001841 IEA:Ensembl P neural tube formation
GO:0022008 IEA:Ensembl P neurogenesis
GO:0044281 TAS:Reactome P small molecule metabolic process
GO:0006744 TAS:Reactome P ubiquinone biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
hsa01100 Metabolic pathways
hsa00130 Ubiquinone and other terpenoid-quinone biosynthesis

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_160111 Ubiquinol biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR009078 Ferritin-like superfamily
IPR012347 Ferritin-related
IPR011566 Ubiquinone biosynthesis protein Coq7

UniProt Annotations

Entry Information

Gene Name
coenzyme Q7 homolog, ubiquinone (yeast)
Protein Entry
COQ7_HUMAN
UniProt ID
Q99807
Species
Human

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q99807-1; Sequence=Displayed; Name=2; IsoId=Q99807-2; Sequence=VSP_039068;
Cofactor Name=Fe cation; Xref=ChEBI
Function Involved in lifespan determination in ubiquinone- independent manner. Involved in ubiquinone biosynthesis. Potential central metabolic regulator (By similarity).
Pathway Cofactor biosynthesis; ubiquinone biosynthesis.
Similarity Belongs to the COQ7 family.
Subcellular Location Mitochondrion inner membrane; Peripheral membrane protein; Matrix side. Note=Synthesized as a preprotein that is imported into the mitochondrial matrix, where the sequence is cleaved off and the mature protein becomes loosely associated with the inner membrane.
Subunit Interacts with ADCK4 and COQ6.
Tissue Specificity Expressed dominantly in heart and skeletal muscle.

Identical and Related Proteins

Unique RefSeq proteins for LMP001090 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
25453484 RefSeq NP_057222 217 ubiquinone biosynthesis protein COQ7 homolog isoform 1
300244542 RefSeq NP_001177912 179 ubiquinone biosynthesis protein COQ7 homolog isoform 2

Identical Sequences to LMP001090 proteins

Reference Database Accession Length Protein Name
GI:25453484 DBBJ BAI46274.1 217 coenzyme Q7 homolog, ubiquinone, partial [synthetic construct]
GI:25453484 GenBank ABL29745.1 217 Sequence 13 from patent US 7132274
GI:25453484 GenBank EAW50268.1 217 coenzyme Q7 homolog, ubiquinone (yeast), isoform CRA_a [Homo sapiens]
GI:300244542 GenBank EAW50271.1 179 coenzyme Q7 homolog, ubiquinone (yeast), isoform CRA_d [Homo sapiens]
GI:25453484 GenBank AED39076.1 217 Sequence 961 from patent US 7883858
GI:25453484 GenBank AIC50554.1 217 COQ7, partial [synthetic construct]
GI:25453484 SwissProt Q99807.3 217 RecName: Full=Ubiquinone biosynthesis protein COQ7 homolog; AltName: Full=Coenzyme Q biosynthesis protein 7 homolog; AltName: Full=Timing protein clk-1 homolog; Flags: Precursor [Homo sapiens]

Related Sequences to LMP001090 proteins

Reference Database Accession Length Protein Name
GI:25453484 DBBJ BAB14876.1 217 unnamed protein product [Homo sapiens]
GI:25453484 DBBJ BAG37856.1 217 unnamed protein product [Homo sapiens]
GI:25453484 EMBL CAE92136.1 217 unnamed protein product [Homo sapiens]
GI:300244542 EMBL CAL37929.1 217 hypothetical protein, partial [synthetic construct]
GI:300244542 EMBL CAL38398.1 217 hypothetical protein, partial [synthetic construct]
GI:25453484 GenBank AAD43648.1 217 COQ7 protein [Homo sapiens]
GI:300244542 GenBank ABL29745.1 217 Sequence 13 from patent US 7132274
GI:300244542 GenBank EAW50268.1 217 coenzyme Q7 homolog, ubiquinone (yeast), isoform CRA_a [Homo sapiens]
GI:25453484 GenBank ACM81398.1 217 Sequence 6896 from patent US 6812339
GI:25453484 GenBank ACM83065.1 226 Sequence 8563 from patent US 6812339
GI:300244542 GenBank AIC50554.1 217 COQ7, partial [synthetic construct]
GI:300244542 RefSeq NP_057222.2 217 ubiquinone biosynthesis protein COQ7 homolog isoform 1 [Homo sapiens]