Gene/Proteome Database (LMPD)
LMPD ID
LMP001084
Gene ID
Species
Homo sapiens (Human)
Gene Name
hydroxysteroid (11-beta) dehydrogenase 1
Gene Symbol
Synonyms
11-DH; 11-beta-HSD1; CORTRD2; HDL; HSD11; HSD11B; HSD11L; SDR26C1
Alternate Names
corticosteroid 11-beta-dehydrogenase isozyme 1; short chain dehydrogenase/reductase family 26C, member 1
Chromosome
1
Map Location
1q32-q41
EC Number
1.1.1.146
Summary
The protein encoded by this gene is a microsomal enzyme that catalyzes the conversion of the stress hormone cortisol to the inactive metabolite cortisone. In addition, the encoded protein can catalyze the reverse reaction, the conversion of cortisone to cortisol. Too much cortisol can lead to central obesity, and a particular variation in this gene has been associated with obesity and insulin resistance in children. Mutations in this gene and H6PD (hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase)) are the cause of cortisone reductase deficiency. Alternate splicing results in multiple transcript variants encoding the same protein.[provided by RefSeq, May 2011]
Orthologs
Proteins
| corticosteroid 11-beta-dehydrogenase isozyme 1 | |
|---|---|
| Refseq ID | NP_861420 |
| Protein GI | 32455239 |
| UniProt ID | P28845 |
| mRNA ID | NM_181755 |
| Length | 292 |
| RefSeq Status | REVIEWED |
| MAFMKKYLLPILGLFMAYYYYSANEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLYSTSYNMDRFINK | |
| corticosteroid 11-beta-dehydrogenase isozyme 1 | |
|---|---|
| Refseq ID | NP_001193670 |
| Protein GI | 332078483 |
| UniProt ID | P28845 |
| mRNA ID | NM_001206741 |
| Length | 292 |
| RefSeq Status | REVIEWED |
| Protein sequence is identical to GI:32455239 (mRNA isoform) | |
Gene Information
Entrez Gene ID
Gene Name
hydroxysteroid (11-beta) dehydrogenase 1
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005789 | TAS:Reactome | C | endoplasmic reticulum membrane |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0016020 | IDA:UniProtKB | C | membrane |
| GO:0070524 | IEA:UniProtKB-EC | F | 11-beta-hydroxysteroid dehydrogenase (NADP+) activity |
| GO:0003845 | TAS:Reactome | F | 11-beta-hydroxysteroid dehydrogenase [NAD(P)] activity |
| GO:0006704 | TAS:Reactome | P | glucocorticoid biosynthetic process |
| GO:0030324 | IEA:Ensembl | P | lung development |
| GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
| GO:0008202 | TAS:Reactome | P | steroid metabolic process |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
hydroxysteroid (11-beta) dehydrogenase 1
Protein Entry
DHI1_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | An 11-beta-hydroxysteroid + NADP(+) = an 11- oxosteroid + NADPH. {ECO |
| Disease | Cortisone reductase deficiency (CRD) [MIM |
| Function | Catalyzes reversibly the conversion of cortisol to the inactive metabolite cortisone. Catalyzes reversibly the conversion of 7-ketocholesterol to 7-beta-hydroxycholesterol. In intact cells, the reaction runs only in one direction, from 7- ketocholesterol to 7-beta-hydroxycholesterol (By similarity). |
| Ptm | Glycosylated. {ECO |
| Similarity | Belongs to the short-chain dehydrogenases/reductases (SDR) family. |
| Subcellular Location | Endoplasmic reticulum membrane ; Single-pass type II membrane protein . |
| Subunit | Homodimer. {ECO |
| Tissue Specificity | Widely expressed. Highest expression in liver. |
Identical and Related Proteins
Unique RefSeq proteins for LMP001084 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 32455239 | RefSeq | NP_861420 | 292 | corticosteroid 11-beta-dehydrogenase isozyme 1 |
Identical Sequences to LMP001084 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:32455239 | GenBank | AFO15778.1 | 292 | Sequence 27 from patent US 8211998 |
| GI:32455239 | GenBank | AGM58110.1 | 292 | Sequence 2 from patent US 8420365 |
| GI:32455239 | GenBank | AHE01237.1 | 292 | Sequence 56153 from patent US 8586006 |
| GI:32455239 | GenBank | AHE01238.1 | 292 | Sequence 56154 from patent US 8586006 |
| GI:32455239 | GenBank | AHW56509.1 | 292 | hydroxysteroid 11-beta dehydrogenase 1 isoform A, partial [Homo sapiens] |
| GI:32455239 | GenBank | AIC54580.1 | 292 | HSD11B1, partial [synthetic construct] |
Related Sequences to LMP001084 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:32455239 | GenBank | JAA06326.1 | 292 | hydroxysteroid (11-beta) dehydrogenase 1 [Pan troglodytes] |
| GI:32455239 | GenBank | JAA20586.1 | 292 | hydroxysteroid (11-beta) dehydrogenase 1 [Pan troglodytes] |
| GI:32455239 | RefSeq | XP_514165.2 | 292 | PREDICTED: corticosteroid 11-beta-dehydrogenase isozyme 1 [Pan troglodytes] |
| GI:32455239 | RefSeq | XP_003831257.1 | 292 | PREDICTED: corticosteroid 11-beta-dehydrogenase isozyme 1 [Pan paniscus] |
| GI:32455239 | RefSeq | XP_004028376.1 | 292 | PREDICTED: corticosteroid 11-beta-dehydrogenase isozyme 1 isoform 2 [Gorilla gorilla gorilla] |
| GI:32455239 | RefSeq | XP_004028377.1 | 292 | PREDICTED: corticosteroid 11-beta-dehydrogenase isozyme 1 isoform 3 [Gorilla gorilla gorilla] |