Gene/Proteome Database (LMPD)
Proteins
| membrane progestin receptor gamma | |
|---|---|
| Refseq ID | NP_001098024 |
| Protein GI | 157389021 |
| UniProt ID | Q9NXK6 |
| mRNA ID | NM_001104554 |
| Length | 330 |
| RefSeq Status | VALIDATED |
| MLSLKLPRLFSIDQIPQVFHEQGILFGYRHPQSSATACILSLFQMTNETLNIWTHLLPFWFFAWRFVTALYMTDIKNDSYSWPMLVYMCTSCVYPLVSSCAHTFSSMSKNARHICYFLDYGAVNLFSLGSAIAYSAYTFPDALMCTTFHDYYVALAVLNTILSTGLSCYSRFLEIQKPRLCKVIRVLAFAYPYTWDSLPIFYRLFLFPGESAQNEATSYHQKHMIMTLLASFLYSAHLPERLAPGRFDYIGHSHQLFHVCVILATHMQMEAILLDKTLRKEWLLATSKPFSFSQIAGAILLCIIFSLSNIIYFSAALYRIPKPELHKKET | |
Gene Information
Entrez Gene ID
Gene Name
progestin and adipoQ receptor family member V
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0004872 | IBA:RefGenome | F | receptor activity |
| GO:0005496 | IEA:UniProtKB-KW | F | steroid binding |
| GO:0007275 | IEA:UniProtKB-KW | P | multicellular organismal development |
| GO:0048477 | IEA:UniProtKB-KW | P | oogenesis |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR004254 | AdipoR/Haemolysin-III-related |
UniProt Annotations
Entry Information
Gene Name
progestin and adipoQ receptor family member V
Protein Entry
MPRG_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Function | Steroid membrane receptor. Binds progesterone. May be involved in oocyte maturation. |
| Similarity | Belongs to the ADIPOR family. |
| Subcellular Location | Membrane ; Multi-pass membrane protein . |
| Tissue Specificity | Expressed in the brain, lung, kidney, colon, adrenal and lung. {ECO |
Identical and Related Proteins
Unique RefSeq proteins for LMP001016 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 157389021 | RefSeq | NP_001098024 | 330 | membrane progestin receptor gamma |
Identical Sequences to LMP001016 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:157389021 | EMBL | CBS99532.1 | 330 | unnamed protein product [Homo sapiens] |
| GI:157389021 | RefSeq | NP_060175.3 | 330 | membrane progestin receptor gamma [Homo sapiens] |
| GI:157389021 | RefSeq | XP_004056454.1 | 330 | PREDICTED: membrane progestin receptor gamma isoform 1 [Gorilla gorilla gorilla] |
| GI:157389021 | RefSeq | XP_004056455.1 | 330 | PREDICTED: membrane progestin receptor gamma isoform 2 [Gorilla gorilla gorilla] |
| GI:157389021 | RefSeq | XP_005254551.1 | 330 | PREDICTED: membrane progestin receptor gamma isoform X1 [Homo sapiens] |
| GI:157389021 | RefSeq | XP_006720646.1 | 330 | PREDICTED: membrane progestin receptor gamma isoform X4 [Homo sapiens] |
Related Sequences to LMP001016 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:157389021 | DBBJ | BAA91004.1 | 330 | unnamed protein product [Homo sapiens] |
| GI:157389021 | GenBank | AAH39234.1 | 330 | Progestin and adipoQ receptor family member V [Homo sapiens] |
| GI:157389021 | GenBank | AAR08371.1 | 330 | progestin and adipoQ receptor family member V [Homo sapiens] |
| GI:157389021 | GenBank | ABM86765.1 | 330 | progestin and adipoQ receptor family member V, partial [synthetic construct] |
| GI:157389021 | GenBank | ABW03821.1 | 330 | progestin and adipoQ receptor family member V [synthetic construct] |
| GI:157389021 | GenBank | AIC56577.1 | 330 | PAQR5, partial [synthetic construct] |