Gene/Proteome Database (LMPD)

LMPD ID
LMP000975
Gene ID
14077
Species
Mus musculus (Mouse)
Gene Name
fatty acid binding protein 3, muscle and heart
Gene Symbol
Fabp3
Synonyms
Fabph-1; Fabph-4; Fabph1; Fabph4; H-FABP; Mdgi
Alternate Names
fatty acid-binding protein, heart; fatty acid-binding protein 3; mammary-derived growth inhibitor; fatty acid binding protein heart 1; fatty acid binding protein heart 4; heart-type fatty acid-binding protein
Chromosome
4
Map Location
4 D2.2|4 63.43 cM

Proteins

fatty acid-binding protein, heart
Refseq ID NP_034304
Protein GI 6753810
UniProt ID P11404
mRNA ID NM_010174
Length 133
RefSeq Status PROVISIONAL
MADAFVGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDTITIKTQSTFKNTEINFQLGIEFDEVTADDRKVKSLVTLDGGKLIHVQKWNGQETTLTRELVDGKLILTLTHGSVVSTRTYEKEA

Gene Information

Entrez Gene ID
14077
Gene Name
fatty acid binding protein 3, muscle and heart
Gene Symbol
Fabp3
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005829 TAS:BHF-UCL C cytosol
GO:0008289 IEA:UniProtKB-KW F lipid binding
GO:0005215 IEA:InterPro F transporter activity
GO:0042632 IMP:BHF-UCL P cholesterol homeostasis
GO:0044539 IMP:BHF-UCL P long-chain fatty acid import
GO:0055091 IMP:BHF-UCL P phospholipid homeostasis
GO:0071073 IC:BHF-UCL P positive regulation of phospholipid biosynthetic process
GO:0046320 IMP:BHF-UCL P regulation of fatty acid oxidation
GO:2001245 IGI:MGI P regulation of phosphatidylcholine biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
ko03320 PPAR signaling pathway
mmu03320 PPAR signaling pathway

Domain Information

InterPro Annotations

Accession Description
IPR012674 Calycin
IPR011038 Calycin-like
IPR000463 Cytosolic fatty-acid binding
IPR000566 Lipocalin/cytosolic fatty-acid binding domain

UniProt Annotations

Entry Information

Gene Name
fatty acid binding protein 3, muscle and heart
Protein Entry
FABPH_MOUSE
UniProt ID
P11404
Species
Mouse

Comments

Comment Type Description
Domain Forms a beta-barrel structure that accommodates the hydrophobic ligand in its interior. {ECO:0000250}.
Function FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters.
Similarity Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family. {ECO:0000305}.
Subcellular Location Cytoplasm.

Identical and Related Proteins

Unique RefSeq proteins for LMP000975 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6753810 RefSeq NP_034304 133 fatty acid-binding protein, heart

Identical Sequences to LMP000975 proteins

Reference Database Accession Length Protein Name
GI:6753810 DBBJ BAE24952.1 133 unnamed protein product [Mus musculus]
GI:6753810 GenBank AAE81089.1 133 Sequence 7 from patent US 6287812
GI:6753810 GenBank AAN21147.1 133 Sequence 11 from patent US 6413726
GI:6753810 GenBank AAH89542.1 133 Fatty acid binding protein 3, muscle and heart [Mus musculus]
GI:6753810 GenBank EDL30140.1 133 fatty acid binding protein 3, muscle and heart [Mus musculus]
GI:6753810 SwissProt P11404.5 133 RecName: Full=Fatty acid-binding protein, heart; AltName: Full=Fatty acid-binding protein 3; AltName: Full=Heart-type fatty acid-binding protein; Short=H-FABP; AltName: Full=Mammary-derived growth inhibitor; Short=MDGI [Mus musculus]

Related Sequences to LMP000975 proteins

Reference Database Accession Length Protein Name
GI:6753810 EMBL CAA33084.1 133 unnamed protein product [Mus musculus]
GI:6753810 GenBank AAA41136.1 133 fatty acid binding protein [Rattus norvegicus]
GI:6753810 GenBank AAE19309.1 131 Sequence 7 from patent US 5844081
GI:6753810 GenBank EDL21444.1 133 mCG8345 [Mus musculus]
GI:6753810 pat US 131 Sequence 7 from patent US 5658758
GI:6753810 SwissProt P07483.2 133 RecName: Full=Fatty acid-binding protein, heart; AltName: Full=Fatty acid-binding protein 3; AltName: Full=Heart-type fatty acid-binding protein; Short=H-FABP [Rattus norvegicus]