Gene/Proteome Database (LMPD)
LMPD ID
LMP000901
Gene ID
Species
Mus musculus (Mouse)
Gene Name
lysophospholipase 1
Gene Symbol
Synonyms
Pla1a
Alternate Names
acyl-protein thioesterase 1; APT-1; LPL-I; lysoPLA I; phospholipase 1a; lysophopholipase 1; lysophospholipase I
Chromosome
1
Map Location
1 A1|1
EC Number
3.1.2.-
Proteins
| acyl-protein thioesterase 1 | |
|---|---|
| Refseq ID | NP_032892 |
| Protein GI | 6678760 |
| UniProt ID | P97823 |
| mRNA ID | NM_008866 |
| Length | 230 |
| RefSeq Status | PROVISIONAL |
| MCGNNMSAPMPAVVPAARKATAAVIFLHGLGDTGHGWAEAFAGIKSPHIKYICPHAPVMPVTLNMNMAMPSWFDIVGLSPDSQEDESGIKQAAETVKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRASFSQGPINSANRDISVLQCHGDCDPLVPLMFGSLTVERLKALINPANVTFKIYEGMMHSSCQQEMMDVKHFIDKLLPPID | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005829 | IDA:MGI | C | cytosol |
| GO:0070062 | IEA:Ensembl | C | extracellular vesicular exosome |
| GO:0005739 | IDA:MGI | C | mitochondrion |
| GO:0008474 | ISS:UniProtKB | F | palmitoyl-(protein) hydrolase activity |
| GO:0006631 | IEA:UniProtKB-KW | P | fatty acid metabolic process |
| GO:0042997 | IMP:MGI | P | negative regulation of Golgi to plasma membrane protein transport |
| GO:0002084 | IMP:MGI | P | protein depalmitoylation |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ko00564 | Glycerophospholipid metabolism |
| mmu00564 | Glycerophospholipid metabolism |
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P97823-1; Sequence=Displayed; Name=2; IsoId=P97823-2; Sequence=VSP_009197; Note=May be due to an intron retention. No experimental confirmation available.; |
| Catalytic Activity | Palmitoyl-protein + H(2)O = palmitate + protein. |
| Function | Hydrolyzes fatty acids from S-acylated cysteine residues in proteins such as trimeric G alpha proteins or HRAS. Has depalmitoylating activity toward KCNMA1. Has low lysophospholipase activity (By similarity). {ECO:0000250}. |
| Sequence Caution | Sequence=BAC34318.1; Type=Erroneous initiation; Evidence={ECO:0000305}; |
| Similarity | Belongs to the AB hydrolase superfamily. AB hydrolase 2 family. {ECO:0000305}. |
| Subcellular Location | Cytoplasm {ECO:0000250}. |
| Subunit | Homodimer. {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP000901 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 6678760 | RefSeq | NP_032892 | 230 | acyl-protein thioesterase 1 |
Identical Sequences to LMP000901 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:6678760 | DBBJ | BAE27497.1 | 230 | unnamed protein product [Mus musculus] |
| GI:6678760 | DBBJ | BAE39355.1 | 230 | unnamed protein product [Mus musculus] |
| GI:6678760 | GenBank | EDL14248.1 | 230 | lysophospholipase 1, isoform CRA_a [Mus musculus] |
| GI:6678760 | GenBank | AEU43366.1 | 230 | Sequence 115 from patent US 8052970 |
| GI:6678760 | RefSeq | NP_001103287.1 | 230 | acyl-protein thioesterase 1 [Oryctolagus cuniculus] |
| GI:6678760 | SwissProt | P97823.1 | 230 | RecName: Full=Acyl-protein thioesterase 1; Short=APT-1; AltName: Full=Lysophospholipase 1; AltName: Full=Lysophospholipase I; Short=LPL-I; Short=LysoPLA I [Mus musculus] |
Related Sequences to LMP000901 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:6678760 | EMBL | CAJ18409.1 | 230 | Lypla1 [Mus musculus] |
| GI:6678760 | GenBank | AAE01610.1 | 230 | Sequence 3 from patent US 5858756 |
| GI:6678760 | GenBank | AAE30798.1 | 230 | Sequence 5 from patent US 5965423 |
| GI:6678760 | GenBank | AAE41537.1 | 230 | Sequence 3 from patent US 6004792 |
| GI:6678760 | GenBank | AAH52848.1 | 230 | Lysophospholipase 1 [Mus musculus] |
| GI:6678760 | RefSeq | NP_037138.1 | 230 | acyl-protein thioesterase 1 [Rattus norvegicus] |