Gene/Proteome Database (LMPD)
LMPD ID
LMP000822
Gene ID
Species
Mus musculus (Mouse)
Gene Name
chemokine (C-X-C motif) ligand 16
Gene Symbol
Synonyms
0910001K24Rik; AV290116; BB024863; CXCL16v1; CXCL16v2; SR-PSOX; Zmynd15; b2b498Clo
Alternate Names
C-X-C motif chemokine 16; SR-PSOX/CXCL16; Mutant line 498; Cxc chemokine ligand 16; small-inducible cytokine B16; transmembrane chemokine CXCL16; zinc finger, MYND-type containing 15; scavenger receptor for phosphatidylserine and oxidized low density lipoprotein
Chromosome
11
Map Location
11|11 B4
Proteins
| C-X-C motif chemokine 16 precursor | |
|---|---|
| Refseq ID | NP_075647 |
| Protein GI | 83745124 |
| UniProt ID | Q8BSU2 |
| mRNA ID | NM_023158 |
| Length | 246 |
| RefSeq Status | PROVISIONAL |
| MRRGFGPLSLAFFLFLLALLTLPGDGNQGSVAGSCSCDRTISSGTQIPQGTLDHIRKYLKAFHRCPFFIRFQLQSKSVCGGSQDQWVRELVDCFERKECGTGHGKSFHHQKHLPQASTQTPEAAEGTPSDTSTPAHSQSTQHSTLPSGALSLNKEHTQPWEMTTLPSGYGLEARPEAEANEKQQDDRQQEAPGAGASTPAWVPVLSLLAIVFFLTAAMAYVLCNRRATQQNSAGLQLWYTPVEPRP | |
| sig_peptide: 1..26 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2823 peptide sequence: MRRGFGPLSLAFFLFLLALLTLPGDG mat_peptide: 27..246 product: C-X-C motif chemokine 16 experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q8BSU2.2) calculated_mol_wt: 24091 peptide sequence: NQGSVAGSCSCDRTISSGTQIPQGTLDHIRKYLKAFHRCPFFIRFQLQSKSVCGGSQDQWVRELVDCFERKECGTGHGKSFHHQKHLPQASTQTPEAAEGTPSDTSTPAHSQSTQHSTLPSGALSLNKEHTQPWEMTTLPSGYGLEARPEAEANEKQQDDRQQEAPGAGASTPAWVPVLSLLAIVFFLTAAMAYVLCNRRATQQNSAGLQLWYTPVEPRP | |
Gene Information
Entrez Gene ID
Gene Name
chemokine (C-X-C motif) ligand 16
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005615 | IEA:UniProtKB-KW | C | extracellular space |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0008009 | IDA:MGI | F | chemokine activity |
| GO:0005041 | IDA:MGI | F | low-density lipoprotein receptor activity |
| GO:0005044 | IDA:MGI | F | scavenger receptor activity |
| GO:0048247 | IEA:InterPro | P | lymphocyte chemotaxis |
| GO:0030307 | IEA:InterPro | P | positive regulation of cell growth |
| GO:0030335 | IEA:InterPro | P | positive regulation of cell migration |
| GO:0034341 | IEA:InterPro | P | response to interferon-gamma |
| GO:0034612 | IEA:InterPro | P | response to tumor necrosis factor |
KEGG Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR026296 | CXC chemokine 16 |
UniProt Annotations
Entry Information
Gene Name
chemokine (C-X-C motif) ligand 16
Protein Entry
CXL16_MOUSE
UniProt ID
Species
Mouse
Comments
| Comment Type | Description |
|---|---|
| Function | Induces a strong chemotactic response. Induces calcium mobilization. Binds to CXCR6/Bonzo. Also acts as a scavenger receptor on macrophages, which specifically binds to OxLDL (oxidized low density lipoprotein), suggesting that it may be involved in pathophysiology such as atherogenesis. {ECO:0000269|PubMed:11060282}. |
| Ptm | Glycosylated. {ECO:0000250}. |
| Similarity | Belongs to the intercrine alpha (chemokine CxC) family. {ECO:0000305}. |
| Subcellular Location | Membrane {ECO:0000305}; Single-pass type I membrane protein {ECO:0000305}. |
| Tissue Specificity | Widely expressed. Not detected in purified B- and T-cells. {ECO:0000269|PubMed:11017100, ECO:0000269|PubMed:20675388}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP000822 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 83745124 | RefSeq | NP_075647 | 246 | C-X-C motif chemokine 16 precursor |
Identical Sequences to LMP000822 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:83745124 | DBBJ | BAE30949.1 | 246 | unnamed protein product [Mus musculus] |
| GI:83745124 | DBBJ | BAE31302.1 | 246 | unnamed protein product [Mus musculus] |
| GI:83745124 | EMBL | CAM28189.1 | 246 | chemokine (C-X-C motif) ligand 16 [Mus musculus] |
| GI:83745124 | EMBL | CDM22052.1 | 246 | unnamed protein product [Mus musculus] |
| GI:83745124 | GenBank | EDL12565.1 | 246 | chemokine (C-X-C motif) ligand 16, isoform CRA_a [Mus musculus] |
| GI:83745124 | GenBank | EDL12566.1 | 246 | chemokine (C-X-C motif) ligand 16, isoform CRA_a [Mus musculus] |
Related Sequences to LMP000822 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:83745124 | DBBJ | BAC27000.1 | 233 | unnamed protein product, partial [Mus musculus] |
| GI:83745124 | DBBJ | BAE29391.1 | 199 | unnamed protein product, partial [Mus musculus] |
| GI:83745124 | EMBL | CAM28188.1 | 233 | chemokine (C-X-C motif) ligand 16, partial [Mus musculus] |
| GI:83745124 | GenBank | AAH19961.1 | 246 | Chemokine (C-X-C motif) ligand 16 [Mus musculus] |
| GI:83745124 | GenBank | EDM05009.1 | 247 | similar to chemokine (C-X-C motif) ligand 16, isoform CRA_b [Rattus norvegicus] |
| GI:83745124 | SwissProt | Q6AXU5.1 | 247 | RecName: Full=C-X-C motif chemokine 16; AltName: Full=Small-inducible cytokine B16; AltName: Full=Transmembrane chemokine CXCL16; Flags: Precursor [Rattus norvegicus] |