Gene/Proteome Database (LMPD)
Proteins
| prostaglandin E2 receptor EP2 subtype | |
|---|---|
| Refseq ID | NP_032990 |
| Protein GI | 6679529 |
| UniProt ID | Q543A9 |
| mRNA ID | NM_008964 |
| Length | 362 |
| RefSeq Status | VALIDATED |
| MDNFLNDSKLMEDCKSRQWLLSGESPAISSVMFSAGVLGNLIALALLARRWRGDTGCSAGSRTSISLFHVLVTELVLTDLLGTCLISPVVLASYSRNQTLVALAPESHACTYFAFTMTFFSLATMLMLFAMALERYLSIGYPYFYRRHLSRRGGLAVLPVIYGASLLFCSLPLLNYGEYVQYCPGTWCFIRHGRTAYLQLYATMLLLLIVAVLACNISVILNLIRMHRRSRRSRCGLSGSSLRGPGSRRRGERTSMAEETDHLILLAIMTITFAICSLPFTIFAYMDETSSLKEKWDLRALRFLSVNSIIDPWVFAILRPPVLRLMRSVLCCRTSLRTQEAQQTSCSTQSSASKQTDLCGQL | |
Gene Information
Entrez Gene ID
Gene Name
prostaglandin E receptor 2 (subtype EP2)
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0004957 | IEA:Ensembl | F | prostaglandin E receptor activity |
| GO:0042127 | IGI:MGI | P | regulation of cell proliferation |
| GO:0032496 | IMP:MGI | P | response to lipopolysaccharide |
Domain Information
UniProt Annotations
Entry Information
Gene Name
prostaglandin E receptor 2 (subtype EP2)
Protein Entry
PE2R2_MOUSE
UniProt ID
Species
Mouse
Identical and Related Proteins
Unique RefSeq proteins for LMP000802 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 6679529 | RefSeq | NP_032990 | 362 | prostaglandin E2 receptor EP2 subtype |
Identical Sequences to LMP000802 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:6679529 | DBBJ | BAC35664.1 | 362 | unnamed protein product [Mus musculus] |
| GI:6679529 | DBBJ | BAE23391.1 | 362 | unnamed protein product [Mus musculus] |
| GI:6679529 | GenBank | AAH05440.1 | 362 | Prostaglandin E receptor 2 (subtype EP2) [Mus musculus] |
| GI:6679529 | GenBank | EDL20685.1 | 362 | prostaglandin E receptor 2 (subtype EP2) [Mus musculus] |
| GI:6679529 | PRF | - | 362 | prostaglandin E receptor EP2 [Mus musculus] |
| GI:6679529 | SwissProt | Q62053.1 | 362 | RecName: Full=Prostaglandin E2 receptor EP2 subtype; Short=PGE receptor EP2 subtype; Short=PGE2 receptor EP2 subtype; AltName: Full=Prostanoid EP2 receptor [Mus musculus] |
Related Sequences to LMP000802 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:6679529 | GenBank | AAA97889.1 | 357 | prostaglandin E receptor EP2 subtype [Rattus norvegicus] |
| GI:6679529 | GenBank | AAB53325.1 | 357 | EP2 prostanoid receptor [Rattus norvegicus] |
| GI:6679529 | GenBank | AAM73855.1 | 357 | prostaglandin E2 receptor type 2 [Rattus norvegicus] |
| GI:6679529 | GenBank | EDL88294.1 | 357 | prostaglandin E receptor 2, subtype EP2 [Rattus norvegicus] |
| GI:6679529 | RefSeq | XP_006994230.1 | 362 | PREDICTED: prostaglandin E2 receptor EP2 subtype [Peromyscus maniculatus bairdii] |
| GI:6679529 | SwissProt | Q62928.1 | 357 | RecName: Full=Prostaglandin E2 receptor EP2 subtype; Short=PGE receptor EP2 subtype; Short=PGE2 receptor EP2 subtype; AltName: Full=Prostanoid EP2 receptor [Rattus norvegicus] |