Gene/Proteome Database (LMPD)
Proteins
| glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1 precursor | |
|---|---|
| Refseq ID | NP_081006 |
| Protein GI | 58037121 |
| UniProt ID | Q9D1N2 |
| mRNA ID | NM_026730 |
| Length | 228 |
| RefSeq Status | PROVISIONAL |
| MKALRAVLLILLLSGQPGSGWAQEDGDADPEPENYNYDDDDDEEEEEETNMIPGSRDRAPLQCYFCQVLHSGESCNQTQSCSSSKPFCITLVSHSGTDKGYLTTYSMWCTDTCQPIIKTVGGTQMTQTCCQSTLCNIPPWQNPQVQNPLGGRADSPLESGTRHPQGGKFSHPQVVKAAHPQSDGANLPKSGKANQPQGSGAGYPSGWTKFGNIALLLSFFTCLWASGA | |
| sig_peptide: 1..22 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2295 peptide sequence: MKALRAVLLILLLSGQPGSGWA mat_peptide: 23..198 product: Glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1 experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q9D1N2.1) calculated_mol_wt: 19184 peptide sequence: QEDGDADPEPENYNYDDDDDEEEEEETNMIPGSRDRAPLQCYFCQVLHSGESCNQTQSCSSSKPFCITLVSHSGTDKGYLTTYSMWCTDTCQPIIKTVGGTQMTQTCCQSTLCNIPPWQNPQVQNPLGGRADSPLESGTRHPQGGKFSHPQVVKAAHPQSDGANLPKSGKANQPQG | |
Gene Information
Entrez Gene ID
Gene Name
GPI-anchored HDL-binding protein 1
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0046658 | IDA:MGI | C | anchored component of plasma membrane |
| GO:0016324 | IDA:BHF-UCL | C | apical plasma membrane |
| GO:0016323 | IDA:BHF-UCL | C | basolateral plasma membrane |
| GO:0009986 | IDA:MGI | C | cell surface |
| GO:0009897 | IDA:BHF-UCL | C | external side of plasma membrane |
| GO:0034364 | IEA:UniProtKB-KW | C | high-density lipoprotein particle |
| GO:0035478 | IMP:BHF-UCL | F | chylomicron binding |
| GO:0008035 | IDA:MGI | F | high-density lipoprotein particle binding |
| GO:0035473 | IPI:BHF-UCL | F | lipase binding |
| GO:0008289 | IEA:UniProtKB-KW | F | lipid binding |
| GO:0071813 | IMP:UniProtKB | F | lipoprotein particle binding |
| GO:0008320 | IDA:BHF-UCL | F | protein transmembrane transporter activity |
| GO:0042632 | IMP:BHF-UCL | P | cholesterol homeostasis |
| GO:0006886 | IDA:BHF-UCL | P | intracellular protein transport |
| GO:0006869 | IDA:MGI | P | lipid transport |
| GO:0090321 | IMP:BHF-UCL | P | positive regulation of chylomicron remnant clearance |
| GO:0090319 | IC:BHF-UCL | P | positive regulation of chylomicron remodeling |
| GO:0051006 | IDA:BHF-UCL | P | positive regulation of lipoprotein lipase activity |
| GO:0017038 | IDA:BHF-UCL | P | protein import |
| GO:0034394 | IDA:BHF-UCL | P | protein localization to cell surface |
| GO:0050821 | IDA:BHF-UCL | P | protein stabilization |
| GO:0071806 | IDA:GOC | P | protein transmembrane transport |
| GO:0045056 | IDA:BHF-UCL | P | transcytosis |
| GO:0070328 | IMP:BHF-UCL | P | triglyceride homeostasis |
Domain Information
UniProt Annotations
Entry Information
Gene Name
GPI-anchored HDL-binding protein 1
Protein Entry
Q9D1N2_MOUSE
UniProt ID
Species
Mouse
Comments
| Comment Type | Description |
|---|---|
| Disruption Phenotype | Mice manifest chylomicronemia, exhibiting a marked accumulation of chylomicrons in the plasma resulting in a milky plasma and plasma triglyceride levels as high as 5000 mg/dl. In Gpihbp1-deficient mice, LPL is mislocalized to the interstitial spaces surrounding myocytes and adipocytes. |
| Function | Plays a key role in the lipolytic processing of chylomicrons. Required for the transport of lipoprotein lipase LPL into the capillary lumen and across endothelial cells. {ECO:0000269|PubMed:17403372, ECO:0000269|PubMed:17620854, ECO:0000269|PubMed:20620994}. |
| Ptm | Glycosylation of Asn-76 is critical for cell surface localization and the binding of chylomicrons and lipoprotein lipase. |
| Similarity | Contains 1 UPAR/Ly6 domain. |
| Subcellular Location | Apical cell membrane; Lipid-anchor, GPI- anchor. Basolateral cell membrane; Lipid-anchor, GPI-anchor. Cell membrane; Peripheral membrane protein; Extracellular side. |
| Subunit | Binds with high affinity to high-density lipoprotein (HDL). Binds to lipoprotein lipase (LPL), chylomicrons and APOA5. {ECO:0000250|UniProtKB:Q8IV16, ECO:0000269|PubMed:12496272, ECO:0000269|PubMed:17403372}. |
| Tissue Specificity | Highly expressed on the luminal surface of capillary endothelium in heart, adipose tissue and skeletal muscle. Not detected in capillaries of the brain. Expressed at lower levels in lung and liver. {ECO:0000269|PubMed:12496272, ECO:0000269|PubMed:17403372}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP000769 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 58037121 | RefSeq | NP_081006 | 228 | glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1 precursor |
Identical Sequences to LMP000769 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:58037121 | DBBJ | BAB22704.1 | 228 | unnamed protein product [Mus musculus] |
| GI:58037121 | DBBJ | BAC23061.1 | 228 | high density lipoprotein binding protein 1 [Mus musculus] |
| GI:58037121 | GenBank | AAH61225.1 | 228 | GPI-anchored HDL-binding protein 1 [Mus musculus] |
| GI:58037121 | GenBank | EDL29479.1 | 228 | GPI-anchored HDL-binding protein 1, isoform CRA_b [Mus musculus] |
| GI:58037121 | SwissProt | Q9D1N2.1 | 228 | RecName: Full=Glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1; Short=GPI-HBP1; Short=GPI-anchored HDL-binding protein 1; AltName: Full=High density lipoprotein-binding protein 1; Flags: Precursor [Mus musculus] |
Related Sequences to LMP000769 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:58037121 | EMBL | CAC37739.1 | 236 | unnamed protein product [Rattus norvegicus] |
| GI:58037121 | GenBank | AAW06790.1 | 236 | Sequence 6 from patent US 6800455 |
| GI:58037121 | GenBank | EDM16060.1 | 236 | similar to high density lipoprotein-binding protein (predicted), isoform CRA_a [Rattus norvegicus] |
| GI:58037121 | GenBank | ABS94084.1 | 236 | Sequence 6 from patent US 7202344 |
| GI:58037121 | RefSeq | NP_001124019.1 | 236 | glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1 precursor [Rattus norvegicus] |
| GI:58037121 | RefSeq | XP_007614843.1 | 286 | PREDICTED: glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1 isoform X2 [Cricetulus griseus] |