Gene/Proteome Database (LMPD)

LMPD ID
LMP000504
Gene ID
246
Species
Homo sapiens (Human)
Gene Name
arachidonate 15-lipoxygenase
Gene Symbol
Synonyms
12-LOX; 15-LOX-1; 15LOX-1
Alternate Names
arachidonate 15-lipoxygenase; 15-LOX; 12/15-lipoxygenase; 15-lipooxygenase-1; arachidonate omega-6 lipoxygenase; arachidonate 12-lipoxygenase, leukocyte-type
Chromosome
17
Map Location
17p13.3
EC Number
1.13.11.33

Proteins

arachidonate 15-lipoxygenase
Refseq ID NP_001131
Protein GI 40316937
UniProt ID P16050
mRNA ID NM_001140
Length 662
RefSeq Status VALIDATED
MGLYRIRVSTGASLYAGSNNQVQLWLVGQHGEAALGKRLWPARGKETELKVEVPEYLGPLLFVKLRKRHLLKDDAWFCNWISVQGPGAGDEVRFPCYRWVEGNGVLSLPEGTGRTVGEDPQGLFQKHREEELEERRKLYRWGNWKDGLILNMAGAKLYDLPVDERFLEDKRVDFEVSLAKGLADLAIKDSLNVLTCWKDLDDFNRIFWCGQSKLAERVRDSWKEDALFGYQFLNGANPVVLRRSAHLPARLVFPPGMEELQAQLEKELEGGTLFEADFSLLDGIKANVILCSQQHLAAPLVMLKLQPDGKLLPMVIQLQLPRTGSPPPPLFLPTDPPMAWLLAKCWVRSSDFQLHELQSHLLRGHLMAEVIVVATMRCLPSIHPIFKLIIPHLRYTLEINVRARTGLVSDMGIFDQIMSTGGGGHVQLLKQAGAFLTYSSFCPPDDLADRGLLGVKSSFYAQDALRLWEIIYRYVEGIVSLHYKTDVAVKDDPELQTWCREITEIGLQGAQDRGFPVSLQARDQVCHFVTMCIFTCTGQHASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASLQMSITWQLGRRQPVMVAVGQHEEEYFSGPEPKAVLKKFREELAALDKEIEIRNAKLDMPYEYLRPSVVENSVAI

Gene Information

Entrez Gene ID
246
Gene Name
arachidonate 15-lipoxygenase
Gene Symbol
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005829 IDA:UniProtKB C cytosol
GO:0031234 IDA:UniProtKB C extrinsic component of cytoplasmic side of plasma membrane
GO:0005811 IDA:UniProtKB C lipid particle
GO:0016020 IDA:UniProtKB C membrane
GO:0005886 ISS:UniProtKB C plasma membrane
GO:0004052 IDA:UniProtKB F arachidonate 12-lipoxygenase activity
GO:0050473 IDA:UniProtKB F arachidonate 15-lipoxygenase activity
GO:0097260 TAS:Reactome F eoxin A4 synthase activity
GO:0005506 ISS:UniProtKB F iron ion binding
GO:0005546 IDA:UniProtKB F phosphatidylinositol-4,5-bisphosphate binding
GO:0043277 ISS:UniProtKB P apoptotic cell clearance
GO:0019369 IDA:UniProtKB P arachidonic acid metabolic process
GO:0030282 ISS:UniProtKB P bone mineralization
GO:0071277 IDA:UniProtKB P cellular response to calcium ion
GO:0035963 IMP:UniProtKB P cellular response to interleukin-13
GO:0051122 ISS:UniProtKB P hepoxilin biosynthetic process
GO:0006954 TAS:ProtInc P inflammatory response
GO:0006691 TAS:Reactome P leukotriene metabolic process
GO:2001303 ISS:UniProtKB P lipoxin A4 biosynthetic process
GO:0019372 IDA:UniProtKB P lipoxygenase pathway
GO:0002820 ISS:UniProtKB P negative regulation of adaptive immune response
GO:0001503 ISS:UniProtKB P ossification
GO:0006646 ISS:UniProtKB P phosphatidylethanolamine biosynthetic process
GO:0070374 IMP:UniProtKB P positive regulation of ERK1 and ERK2 cascade
GO:0030838 ISS:UniProtKB P positive regulation of actin filament polymerization
GO:0010811 IDA:UniProtKB P positive regulation of cell-substrate adhesion
GO:1901074 ISS:UniProtKB P regulation of engulfment of apoptotic cell
GO:0035358 ISS:UniProtKB P regulation of peroxisome proliferator activated receptor signaling pathway
GO:0034976 ISS:UniProtKB P response to endoplasmic reticulum stress
GO:0044281 TAS:Reactome P small molecule metabolic process
GO:0042060 ISS:UniProtKB P wound healing

KEGG Pathway Links

KEGG Pathway ID Description
hsa04726 Serotonergic synapse

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_150201 Synthesis of 12-eicosatetraenoic acid derivatives
REACT_150422 Synthesis of 15-eicosatetraenoic acid derivatives

Domain Information

InterPro Annotations

Accession Description
IPR008976 Lipase/lipooxygenase, PLAT/LH2
IPR000907 Lipoxygenase
IPR013819 Lipoxygenase, C-terminal
IPR020834 Lipoxygenase, conserved site
IPR020833 Lipoxygenase, iron binding site
IPR001885 Lipoxygenase, mammalian
IPR001024 PLAT/LH2 domain

UniProt Annotations

Entry Information

Gene Name
arachidonate 15-lipoxygenase
Protein Entry
LOX15_HUMAN
UniProt ID
Species
Human

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P16050-1; Sequence=Displayed; Name=2; IsoId=P16050-2; Sequence=VSP_056681; Note=No experimental confirmation available.;
Catalytic Activity Arachidonate + O(2) = (5Z,8Z,10E,14Z)-(12S)- 12-hydroperoxyicosa-5,8,10,14-tetraenoate.
Catalytic Activity Arachidonate + O(2) = (5Z,8Z,11Z,13E)-(15S)- 15-hydroperoxyicosa-5,8,11,13-tetraenoate.
Cofactor Name=Fe cation; Xref=ChEBI
Disease Note=Disease susceptibility may be associated with variations affecting the gene represented in this entry. Met at position 560 may confer interindividual susceptibility to coronary artery disease (CAD) (PubMed:17959182).
Domain The PLAT domain can bind calcium ions; this promotes association with membranes.
Enzyme Regulation Activity is increased by binding phosphatidylinositol phosphates, especially phosphatidylinositol 3,4-bisphosphate and phosphatidylinositol 4,5-bisphosphate.
Function Non-heme iron-containing dioxygenase that catalyzes the stereo-specific peroxidation of free and esterified polyunsaturated fatty acids generating a spectrum of bioactive lipid mediators. Converts arachidonic acid into 12- hydroperoxyeicosatetraenoic acid/12-HPETE and 15- hydroperoxyeicosatetraenoic acid/15-HPETE. Also converts linoleic acid to 13-hydroperoxyoctadecadienoic acid. May also act on (12S)- hydroperoxyeicosatetraenoic acid/(12S)-HPETE to produce hepoxilin A3. Probably plays an important role in the immune and inflammatory responses. Through the oxygenation of membrane-bound phosphatidylethanolamine in macrophages may favor clearance of apoptotic cells during inflammation by resident macrophages and prevent an autoimmune response associated with the clearance of apoptotic cells by inflammatory monocytes. In parallel, may regulate actin polymerization which is crucial for several biological processes, including macrophage function. May also regulate macrophage function through regulation of the peroxisome proliferator activated receptor signaling pathway. Finally, it is also involved in the cellular response to IL13/interleukin-13. In addition to its role in the immune and inflammatory responses, may play a role in epithelial wound healing in the cornea maybe through production of lipoxin A4. May also play a role in endoplasmic reticulum stress response and the regulation of bone mass.
Induction Up-regulated by UV-irradiation.
Pathway Lipid metabolism; hydroperoxy eicosatetraenoic acid biosynthesis.
Similarity Belongs to the lipoxygenase family.
Similarity Contains 1 PLAT domain. {ECO
Similarity Contains 1 lipoxygenase domain. {ECO
Subcellular Location Cytoplasm, cytosol. Cell membrane; Peripheral membrane protein. Lipid droplet. Note=Predominantly cytosolic; becomes enriched at membranes upon calcium binding. Translocates from the cytosol to the plasma membrane when stimulated by IL13/interleukin-13 and in macrophages binding apoptotic cells.
Subunit Interacts with PEBP1; in response to IL13/interleukin-13, prevents the interaction of PEBP1 with RAF1 to activate the ERK signaling cascade.
Tissue Specificity Detected in monocytes and eosinophils (at protein level). Expressed in airway epithelial cells.
Web Resource Name=Atlas of Genetics and Cytogenetics in Oncology and Haematology; URL="http://atlasgeneticsoncology.org/Genes/ALOX15ID42986ch17p13.html";
Web Resource Name=SeattleSNPs; URL="http://pga.gs.washington.edu/data/alox15/";

Identical and Related Proteins

Unique RefSeq proteins for LMP000504 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
40316937 RefSeq NP_001131 662 arachidonate 15-lipoxygenase

Identical Sequences to LMP000504 proteins

Reference Database Accession Length Protein Name
GI:40316937 DBBJ BAF82998.1 662 unnamed protein product [Homo sapiens]
GI:40316937 DBBJ BAJ20998.1 662 arachidonate 15-lipoxygenase, partial [synthetic construct]
GI:40316937 GenBank AAR77023.1 662 Sequence 25 from patent US 6649355
GI:40316937 GenBank AAR84235.1 662 arachidonate 15-lipoxygenase [Homo sapiens]
GI:40316937 GenBank AAY75412.1 662 Sequence 315 from patent US 6900016
GI:40316937 GenBank AHE03456.1 662 Sequence 65264 from patent US 8586006

Related Sequences to LMP000504 proteins

Reference Database Accession Length Protein Name
GI:40316937 DBBJ BAG35454.1 662 unnamed protein product [Homo sapiens]
GI:40316937 DBBJ BAH12437.1 684 unnamed protein product [Homo sapiens]
GI:40316937 GenBank AAH29032.1 662 Arachidonate 15-lipoxygenase [Homo sapiens]
GI:40316937 GenBank AIC53988.1 662 ALOX15, partial [synthetic construct]
GI:40316937 RefSeq XP_003315361.1 684 PREDICTED: arachidonate 15-lipoxygenase [Pan troglodytes]
GI:40316937 RefSeq XP_008960822.1 662 PREDICTED: arachidonate 15-lipoxygenase [Pan paniscus]