Gene/Proteome Database (LMPD)

LMPD ID
LMP000503
Gene ID
16846
Species
Mus musculus (Mouse)
Gene Name
leptin
Gene Symbol
Lep
Synonyms
ob; obese
Alternate Names
leptin; obesity factor
Chromosome
6
Map Location
6 A3.3|6 12.3 cM

Proteins

leptin precursor
Refseq ID NP_032519
Protein GI 6678678
UniProt ID P41160
mRNA ID NM_008493
Length 167
RefSeq Status VALIDATED
MCWRPLCRFLWLWSYLSYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQSVSAKQRVTGLDFIPGLHPILSLSKMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLHLLAFSKSCSLPQTSGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDVSPEC
sig_peptide: 1..21 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2722 peptide sequence: MCWRPLCRFLWLWSYLSYVQA mat_peptide: 22..167 product: Leptin experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (P41160.1) calculated_mol_wt: 16004 peptide sequence: VPIQKVQDDTKTLIKTIVTRINDISHTQSVSAKQRVTGLDFIPGLHPILSLSKMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLHLLAFSKSCSLPQTSGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDVSPEC

Gene Information

Entrez Gene ID
16846
Gene Name
leptin
Gene Symbol
Lep
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 IDA:BHF-UCL C cytoplasm
GO:0005576 TAS:Reactome C extracellular region
GO:0005615 IDA:BHF-UCL C extracellular space
GO:0008083 IDA:MGI F growth factor activity
GO:0060612 IGI:MGI P adipose tissue development
GO:0008343 IDA:HGNC P adult feeding behavior
GO:0008206 IDA:MGI P bile acid metabolic process
GO:0035630 IEA:Ensembl P bone mineralization involved in bone maturation
GO:0071298 IEA:Ensembl P cellular response to L-ascorbic acid
GO:0071300 IEA:Ensembl P cellular response to retinoic acid
GO:0021954 IMP:MGI P central nervous system neuron development
GO:0008203 IGI:MGI P cholesterol metabolic process
GO:0007623 IEA:Ensembl P circadian rhythm
GO:0042755 IGI:MGI P eating behavior
GO:0006112 IEA:Ensembl P energy reserve metabolic process
GO:0006635 IGI:MGI P fatty acid beta-oxidation
GO:0007565 IEA:Ensembl P female pregnancy
GO:0042593 IGI:MGI P glucose homeostasis
GO:0006006 IMP:MGI P glucose metabolic process
GO:0006114 IEA:Ensembl P glycerol biosynthetic process
GO:0042445 IMP:MGI P hormone metabolic process
GO:0030073 IGI:MGI P insulin secretion
GO:0033210 IEA:Ensembl P leptin-mediated signaling pathway
GO:0050901 IEA:Ensembl P leukocyte tethering or rolling
GO:0006629 IMP:MGI P lipid metabolic process
GO:0043066 IEA:Ensembl P negative regulation of apoptotic process
GO:0032099 IDA:HGNC P negative regulation of appetite
GO:0061037 IEA:Ensembl P negative regulation of cartilage development
GO:0070093 IDA:BHF-UCL P negative regulation of glucagon secretion
GO:2000486 IEA:Ensembl P negative regulation of glutamine transport
GO:0000122 IDA:BHF-UCL P negative regulation of transcription from RNA polymerase II promoter
GO:0045906 IEA:Ensembl P negative regulation of vasoconstriction
GO:0001542 IEA:Ensembl P ovulation from ovarian follicle
GO:0001890 IEA:Ensembl P placenta development
GO:0046427 IDA:BHF-UCL P positive regulation of JAK-STAT cascade
GO:0043410 IEA:Ensembl P positive regulation of MAPK cascade
GO:2000366 IDA:BHF-UCL P positive regulation of STAT protein import into nucleus
GO:0008284 IEA:Ensembl P positive regulation of cell proliferation
GO:0001819 IEA:Ensembl P positive regulation of cytokine production
GO:0048639 IEA:Ensembl P positive regulation of developmental growth
GO:0046881 IEA:Ensembl P positive regulation of follicle-stimulating hormone secretion
GO:2000491 IEA:Ensembl P positive regulation of hepatic stellate cell activation
GO:0046628 IEA:Ensembl P positive regulation of insulin receptor signaling pathway
GO:0043270 IEA:Ensembl P positive regulation of ion transport
GO:0033686 IEA:Ensembl P positive regulation of luteinizing hormone secretion
GO:0045639 IDA:MGI P positive regulation of myeloid cell differentiation
GO:0042307 IDA:BHF-UCL P positive regulation of protein import into nucleus
GO:0042517 IEA:Ensembl P positive regulation of tyrosine phosphorylation of Stat3 protein
GO:0008217 IEA:Ensembl P regulation of blood pressure
GO:0045598 IGI:MGI P regulation of fat cell differentiation
GO:0006111 IMP:MGI P regulation of gluconeogenesis
GO:0050796 IMP:MGI P regulation of insulin secretion
GO:0030300 IDA:MGI P regulation of intestinal cholesterol absorption
GO:0060587 IEA:Ensembl P regulation of lipoprotein lipid oxidation
GO:0019222 IMP:MGI P regulation of metabolic process
GO:1900180 IMP:MGI P regulation of protein localization to nucleus
GO:0001932 IDA:BHF-UCL P regulation of protein phosphorylation
GO:0050810 IMP:MGI P regulation of steroid biosynthetic process
GO:0002021 IMP:MGI P response to dietary excess
GO:0001666 IEA:Ensembl P response to hypoxia
GO:0032868 IMP:MGI P response to insulin
GO:0033197 IEA:Ensembl P response to vitamin E
GO:0007260 IDA:BHF-UCL P tyrosine phosphorylation of STAT protein

KEGG Pathway Links

KEGG Pathway ID Description
mmu04152 AMPK signaling pathway
mmu04932 Non-alcoholic fatty liver disease (NAFLD)

Domain Information

InterPro Annotations

Accession Description
IPR012351 Four-helical cytokine, core
IPR009079 Four-helical cytokine-like, core
IPR000065 Leptin

UniProt Annotations

Entry Information

Gene Name
leptin
Protein Entry
LEP_MOUSE
UniProt ID
P41160
Species
Mouse

Comments

Comment Type Description
Disease Note=Defects in Lep are the cause of profound obesity and type II diabetes.
Function May function as part of a signaling pathway that acts to regulate the size of the body fat depot. An increase in the level of LEP may act directly or indirectly on the CNS to inhibit food intake and/or regulate energy expenditure as part of a homeostatic mechanism to maintain constancy of the adipose mass.
Similarity Belongs to the leptin family. {ECO:0000305}.
Subcellular Location Secreted {ECO:0000305}.

Identical and Related Proteins

Unique RefSeq proteins for LMP000503 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6678678 RefSeq NP_032519 167 leptin precursor

Identical Sequences to LMP000503 proteins

Reference Database Accession Length Protein Name
GI:6678678 GenBank ACV97597.1 167 Sequence 2 from patent US 7544492
GI:6678678 GenBank ADS38181.1 167 Sequence 1 from patent US 7790683
GI:6678678 GenBank AEN31165.1 167 Sequence 2 from patent US 7994301
GI:6678678 GenBank AEP59453.1 167 Sequence 1 from patent US 8022189
GI:6678678 GenBank AEU59582.1 167 Sequence 1 from patent US 8067545
GI:6678678 GenBank AFL33613.1 167 Sequence 2 from patent US 8173793

Related Sequences to LMP000503 proteins

Reference Database Accession Length Protein Name
GI:6678678 GenBank AAE85346.1 166 Sequence 5 from patent US 6309853
GI:6678678 GenBank AAN26312.1 166 Sequence 5 from patent US 6429290
GI:6678678 GenBank AAN95809.1 166 Sequence 5 from patent US 6471956
GI:6678678 GenBank AAU99416.1 166 Sequence 5 from patent US 6734160
GI:6678678 GenBank ADM72802.1 167 leptin [Mus musculus]
GI:6678678 GenBank AEN31167.1 166 Sequence 5 from patent US 7994301