Gene/Proteome Database (LMPD)
LMPD ID
LMP000461
Gene ID
Species
Homo sapiens (Human)
Gene Name
hydroxysteroid (17-beta) dehydrogenase 8
Gene Symbol
Synonyms
D6S2245E; FABG; FABGL; H2-KE6; HKE6; KE6; RING2; SDR30C1; dJ1033B10.9
Alternate Names
estradiol 17-beta-dehydrogenase 8; ke-6; protein Ke6; 17-beta-HSD 8; estrogen 17-oxidoreductase; testosterone 17-beta-dehydrogenase 8; really interesting new gene 2 protein; 17-beta-hydroxysteroid dehydrogenase 8; 3-oxoacyl-[acyl-carrier-protein] reductase; short chain dehydrogenase/reductase family 30C, member 1
Chromosome
6
Map Location
6p21.3
EC Number
1.1.1.62
Summary
In mice, the Ke6 protein is a 17-beta-hydroxysteroid dehydrogenase that can regulate the concentration of biologically active estrogens and androgens. It is preferentially an oxidative enzyme and inactivates estradiol, testosterone, and dihydrotestosterone. However, the enzyme has some reductive activity and can synthesize estradiol from estrone. The protein encoded by this gene is similar to Ke6 and is a member of the short-chain dehydrogenase superfamily. An alternatively spliced transcript of this gene has been detected, but the full-length nature of this variant has not been determined. [provided by RefSeq, Jul 2008]
Orthologs
Proteins
| estradiol 17-beta-dehydrogenase 8 | |
|---|---|
| Refseq ID | NP_055049 |
| Protein GI | 15277342 |
| UniProt ID | Q92506 |
| mRNA ID | NM_014234 |
| Length | 261 |
| RefSeq Status | REVIEWED |
| MASQLQNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQETVRLLGGPGSKEGPPRGNHAAFQADVSEARAARCLLEQVQACFSRPPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCRGSIINISSIVGKVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGYITGTSVEVTGGLFM | |
Gene Information
Entrez Gene ID
Gene Name
hydroxysteroid (17-beta) dehydrogenase 8
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005740 | IEA:Ensembl | C | mitochondrial envelope |
| GO:0005759 | IDA:UniProtKB | C | mitochondrial matrix |
| GO:0005886 | IEA:Ensembl | C | plasma membrane |
| GO:0003857 | IDA:UniProtKB | F | 3-hydroxyacyl-CoA dehydrogenase activity |
| GO:0004303 | IDA:UniProtKB | F | estradiol 17-beta-dehydrogenase activity |
| GO:0047035 | IEA:UniProtKB-EC | F | testosterone dehydrogenase (NAD+) activity |
| GO:0008209 | IEA:Ensembl | P | androgen metabolic process |
| GO:0006703 | IDA:UniProtKB | P | estrogen biosynthetic process |
| GO:0006633 | IEA:UniProtKB-UniPathway | P | fatty acid biosynthetic process |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
hydroxysteroid (17-beta) dehydrogenase 8
Protein Entry
DHB8_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | 17-beta-estradiol + NAD(P)(+) = estrone + NAD(P)H. |
| Catalytic Activity | Testosterone + NAD(+) = androstenedione + NADH. |
| Function | NAD-dependent 17-beta-hydroxysteroid dehydrogenase with highest activity towards estradiol. Has very low activity towards testosterone. The heteroteramer with CBR4 has NADH-dependent 3- ketoacyl-acyl carrier protein reductase activity. May play a role in biosynthesis of fatty acids in mitochondria. |
| Induction | Up-regulated by estradiol. |
| Pathway | Lipid metabolism; fatty acid biosynthesis. |
| Pathway | Steroid biosynthesis; estrogen biosynthesis. |
| Similarity | Belongs to the short-chain dehydrogenases/reductases (SDR) family. |
| Subcellular Location | Mitochondrion matrix . |
| Subunit | Heterotetramer with CBR4; contains two molecules of HSD17B8 and CBR4. |
| Tissue Specificity | Highly expressed in placenta, liver and pancreas, lower in the skeletal muscle and kidney. Widely expressed. |
Identical and Related Proteins
Unique RefSeq proteins for LMP000461 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 15277342 | RefSeq | NP_055049 | 261 | estradiol 17-beta-dehydrogenase 8 |
Identical Sequences to LMP000461 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15277342 | PDB | 4CQM | 261 | Chain E, Crystal Structure Of Heterotetrameric Human Ketoacyl Reductase Complexed With Nad And Nadp |
| GI:15277342 | PDB | 4CQM | 261 | Chain H, Crystal Structure Of Heterotetrameric Human Ketoacyl Reductase Complexed With Nad And Nadp |
| GI:15277342 | PDB | 4CQM | 261 | Chain I, Crystal Structure Of Heterotetrameric Human Ketoacyl Reductase Complexed With Nad And Nadp |
| GI:15277342 | PDB | 4CQM | 261 | Chain L, Crystal Structure Of Heterotetrameric Human Ketoacyl Reductase Complexed With Nad And Nadp |
| GI:15277342 | PDB | 4CQM | 261 | Chain M, Crystal Structure Of Heterotetrameric Human Ketoacyl Reductase Complexed With Nad And Nadp |
| GI:15277342 | PDB | 4CQM | 261 | Chain P, Crystal Structure Of Heterotetrameric Human Ketoacyl Reductase Complexed With Nad And Nadp |
Related Sequences to LMP000461 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15277342 | GenBank | AAP36896.1 | 262 | Homo sapiens hydroxysteroid (17-beta) dehydrogenase 8, partial [synthetic construct] |
| GI:15277342 | GenBank | AAX43639.1 | 262 | hydroxysteroid (17-beta) dehydrogenase 8, partial [synthetic construct] |
| GI:15277342 | GenBank | AAX43640.1 | 262 | hydroxysteroid (17-beta) dehydrogenase 8, partial [synthetic construct] |
| GI:15277342 | PDB | 2PD6 | 264 | Chain B, Structure Of Human Hydroxysteroid Dehydrogenase Type 8, Hsd17b8 |
| GI:15277342 | PDB | 4CQM | 261 | Chain D, Crystal Structure Of Heterotetrameric Human Ketoacyl Reductase Complexed With Nad And Nadp |
| GI:15277342 | RefSeq | XP_004043851.1 | 261 | PREDICTED: estradiol 17-beta-dehydrogenase 8 [Gorilla gorilla gorilla] |