Gene/Proteome Database (LMPD)
LMPD ID
LMP000402
Gene ID
Species
Homo sapiens (Human)
Gene Name
apolipoprotein C-I
Gene Symbol
Synonyms
Apo-CI; ApoC-I
Alternate Names
apolipoprotein C-I; apo-CIB; apoC-IB; apolipoprotein C1; apolipoprotein C-I variant I
Chromosome
19
Map Location
19q13.2
Summary
The protein encoded by this gene is a member of the apolipoprotein C1 family. This gene is expressed primarily in the liver, and it is activated when monocytes differentiate into macrophages. A pseudogene of this gene is located 4 kb downstream in the same orientation, on the same chromosome. This gene is mapped to chromosome 19, where it resides within a apolipoprotein gene cluster. Alternatively spliced transcript variants have been found for this gene, but the biological validity of some variants has not been determined. [provided by RefSeq, Jul 2008]
Orthologs
Proteins
| apolipoprotein C-I precursor | |
|---|---|
| Refseq ID | NP_001636 |
| Protein GI | 4502157 |
| UniProt ID | P02654 |
| mRNA ID | NM_001645 |
| Length | 83 |
| RefSeq Status | REVIEWED |
| MRLFLSLPVLVVVLSIVLEGPAPAQGTPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLKIDS | |
| sig_peptide: 1..26 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2719 peptide sequence: MRLFLSLPVLVVVLSIVLEGPAPAQG mat_peptide: 27..83 product: apolipoprotein C-I calculated_mol_wt: 6631 peptide sequence: TPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLKIDS | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0042627 | TAS:BHF-UCL | C | chylomicron |
| GO:0005783 | IDA:LIFEdb | C | endoplasmic reticulum |
| GO:0070062 | IDA:UniProt | C | extracellular vesicular exosome |
| GO:0034364 | IDA:BHF-UCL | C | high-density lipoprotein particle |
| GO:0034361 | IDA:BHF-UCL | C | very-low-density lipoprotein particle |
| GO:0005504 | IDA:BHF-UCL | F | fatty acid binding |
| GO:0055102 | IDA:BHF-UCL | F | lipase inhibitor activity |
| GO:0031210 | TAS:BHF-UCL | F | phosphatidylcholine binding |
| GO:0060228 | TAS:BHF-UCL | F | phosphatidylcholine-sterol O-acyltransferase activator activity |
| GO:0004859 | IDA:BHF-UCL | F | phospholipase inhibitor activity |
| GO:0033344 | IDA:BHF-UCL | P | cholesterol efflux |
| GO:0008203 | IEA:Ensembl | P | cholesterol metabolic process |
| GO:0034382 | IDA:BHF-UCL | P | chylomicron remnant clearance |
| GO:0034375 | TAS:BHF-UCL | P | high-density lipoprotein particle remodeling |
| GO:0006629 | TAS:ProtInc | P | lipid metabolic process |
| GO:0042157 | IEA:InterPro | P | lipoprotein metabolic process |
| GO:0032375 | IDA:BHF-UCL | P | negative regulation of cholesterol transport |
| GO:0045717 | IDA:BHF-UCL | P | negative regulation of fatty acid biosynthetic process |
| GO:0050995 | IDA:BHF-UCL | P | negative regulation of lipid catabolic process |
| GO:0045833 | IDA:BHF-UCL | P | negative regulation of lipid metabolic process |
| GO:0051005 | IDA:BHF-UCL | P | negative regulation of lipoprotein lipase activity |
| GO:0010900 | IDA:BHF-UCL | P | negative regulation of phosphatidylcholine catabolic process |
| GO:0048261 | IDA:BHF-UCL | P | negative regulation of receptor-mediated endocytosis |
| GO:0010916 | IDA:BHF-UCL | P | negative regulation of very-low-density lipoprotein particle clearance |
| GO:0033700 | IDA:BHF-UCL | P | phospholipid efflux |
| GO:0034369 | IDA:BHF-UCL | P | plasma lipoprotein particle remodeling |
| GO:0043085 | TAS:GOC | P | positive regulation of catalytic activity |
| GO:0010873 | TAS:BHF-UCL | P | positive regulation of cholesterol esterification |
| GO:0032374 | IC:BHF-UCL | P | regulation of cholesterol transport |
| GO:0006641 | IEA:Ensembl | P | triglyceride metabolic process |
| GO:0034379 | TAS:BHF-UCL | P | very-low-density lipoprotein particle assembly |
| GO:0034447 | IGI:BHF-UCL | P | very-low-density lipoprotein particle clearance |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR006781 | Apolipoprotein C-I |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Function | Inhibitor of lipoprotein binding to the low density lipoprotein (LDL) receptor, LDL receptor-related protein, and very low density lipoprotein (VLDL) receptor. Associates with high density lipoproteins (HDL) and the triacylglycerol-rich lipoproteins in the plasma and makes up about 10% of the protein of the VLDL and 2% of that of HDL. Appears to interfere directly with fatty acid uptake and is also the major plasma inhibitor of cholesteryl ester transfer protein (CETP). Binds free fatty acids and reduces their intracellular esterification. Modulates the interaction of APOE with beta-migrating VLDL and inhibits binding of beta-VLDL to the LDL receptor-related protein. |
| Miscellaneous | Apolipoprotein C-I is present in acidic (APOC1A) and basic (APOC1B) forms in P.paniscus, P.abelii and P.troglodytes and perhaps also in baboons and macaques. The two genes for ApoC-I arose through a duplication process that occurred after the divergence of New World monkeys from the human lineage. In human, the acidic form has become a pseudogene sometime between the divergence of bonobos and chimpanzees from the human lineage and the appearance of the Denisovans. Pseudogenization resulted when the codon for the penultimate amino acid in the signal sequence was changed to a stop codon. |
| Similarity | Belongs to the apolipoprotein C1 family. |
| Subcellular Location | Secreted . |
| Tissue Specificity | Synthesized mainly in liver and to a minor degree in intestine. Also found in the lung and spleen. |
| Web Resource | Name=Wikipedia; Note=Apolipoprotein C1 entry; URL="http://en.wikipedia.org/wiki/Apolipoprotein_C1"; |
Identical and Related Proteins
Unique RefSeq proteins for LMP000402 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 4502157 | RefSeq | NP_001636 | 83 | apolipoprotein C-I precursor |
Identical Sequences to LMP000402 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:4502157 | DBBJ | BAI46533.1 | 83 | apolipoprotein C-I, partial [synthetic construct] |
| GI:4502157 | GenBank | ACT64519.1 | 83 | apolipoprotein C-I protein, partial [synthetic construct] |
| GI:4502157 | GenBank | AFQ78689.1 | 83 | Sequence 5 from patent US 8241861 |
| GI:4502157 | GenBank | AGP16942.1 | 83 | Sequence 5 from patent US 8460889 |
| GI:4502157 | GenBank | AHD69372.1 | 83 | Sequence 386 from patent US 8586006 |
| GI:4502157 | RefSeq | XP_005258912.1 | 83 | PREDICTED: apolipoprotein C-I isoform X1 [Homo sapiens] |
Related Sequences to LMP000402 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:4502157 | EMBL | CAD61385.1 | 83 | unnamed protein product [Homo sapiens] |
| GI:4502157 | EMBL | CAD61551.1 | 83 | unnamed protein product [Homo sapiens] |
| GI:4502157 | GenBank | AAP36875.1 | 84 | Homo sapiens apolipoprotein C-I, partial [synthetic construct] |
| GI:4502157 | GenBank | AAX43590.1 | 84 | apolipoprotein C-I, partial [synthetic construct] |
| GI:4502157 | GenBank | AAX43591.1 | 84 | apolipoprotein C-I, partial [synthetic construct] |
| GI:4502157 | RefSeq | XP_003316492.1 | 83 | PREDICTED: apolipoprotein C-I, basic form [Pan troglodytes] |