Gene/Proteome Database (LMPD)

LMPD ID
LMP000398
Gene ID
336
Species
Homo sapiens (Human)
Gene Name
apolipoprotein A-II
Gene Symbol
APOA2
Synonyms
Apo-AII; ApoA-II; apoAII
Alternate Names
apolipoprotein A-II; apolipoprotein A2
Chromosome
1
Map Location
1q23.3
Summary
This gene encodes apolipoprotein (apo-) A-II, which is the second most abundant protein of the high density lipoprotein particles. The protein is found in plasma as a monomer, homodimer, or heterodimer with apolipoprotein D. Defects in this gene may result in apolipoprotein A-II deficiency or hypercholesterolemia. [provided by RefSeq, Jul 2008]
Orthologs
View orthologs and multiple alignments for APOA2

Proteins

apolipoprotein A-II preproprotein
Refseq ID NP_001634
Protein GI 4502149
UniProt ID P02652
mRNA ID NM_001643
Length 100
RefSeq Status REVIEWED
MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ
sig_peptide: 1..18 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 1889 peptide sequence: MKLLAATVLLLTICSLEG mat_peptide: 24..100 product: apolipoprotein A-II calculated_mol_wt: 8708 peptide sequence: QAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ

Gene Information

Entrez Gene ID
336
Gene Name
apolipoprotein A-II
Gene Symbol
APOA2
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0072562 IDA:UniProt C blood microparticle
GO:0042627 IDA:BHF-UCL C chylomicron
GO:0005829 TAS:Reactome C cytosol
GO:0005769 TAS:Reactome C early endosome
GO:0005788 TAS:Reactome C endoplasmic reticulum lumen
GO:0005576 NAS:UniProtKB C extracellular region
GO:0070062 IDA:UniProtKB C extracellular vesicular exosome
GO:0034364 IDA:BHF-UCL C high-density lipoprotein particle
GO:0034366 IDA:BHF-UCL C spherical high-density lipoprotein particle
GO:0034361 IDA:BHF-UCL C very-low-density lipoprotein particle
GO:0034190 IPI:BHF-UCL F apolipoprotein receptor binding
GO:0015485 IDA:BHF-UCL F cholesterol binding
GO:0017127 IEA:Ensembl F cholesterol transporter activity
GO:0008035 IEA:Ensembl F high-density lipoprotein particle binding
GO:0070653 IPI:BHF-UCL F high-density lipoprotein particle receptor binding
GO:0055102 IDA:BHF-UCL F lipase inhibitor activity
GO:0008289 IDA:BHF-UCL F lipid binding
GO:0005319 IDA:BHF-UCL F lipid transporter activity
GO:0031210 IDA:BHF-UCL F phosphatidylcholine binding
GO:0060228 IDA:BHF-UCL F phosphatidylcholine-sterol O-acyltransferase activator activity
GO:0005543 IDA:BHF-UCL F phospholipid binding
GO:0046982 IPI:UniProtKB F protein heterodimerization activity
GO:0042803 IDA:BHF-UCL F protein homodimerization activity
GO:0002526 IEA:Ensembl P acute inflammatory response
GO:0044255 TAS:Reactome P cellular lipid metabolic process
GO:0033344 IDA:BHF-UCL P cholesterol efflux
GO:0042632 IDA:BHF-UCL P cholesterol homeostasis
GO:0008203 IEA:Ensembl P cholesterol metabolic process
GO:0046340 IDA:BHF-UCL P diacylglycerol catabolic process
GO:0034380 IDA:BHF-UCL P high-density lipoprotein particle assembly
GO:0034384 IDA:BHF-UCL P high-density lipoprotein particle clearance
GO:0034375 IDA:BHF-UCL P high-density lipoprotein particle remodeling
GO:0042157 TAS:Reactome P lipoprotein metabolic process
GO:0034374 IDA:BHF-UCL P low-density lipoprotein particle remodeling
GO:0060621 IDA:BHF-UCL P negative regulation of cholesterol import
GO:0032375 IMP:BHF-UCL P negative regulation of cholesterol transport
GO:0060695 IDA:BHF-UCL P negative regulation of cholesterol transporter activity
GO:0002740 IDA:BHF-UCL P negative regulation of cytokine secretion involved in immune response
GO:0060192 IDA:BHF-UCL P negative regulation of lipase activity
GO:0050995 IDA:BHF-UCL P negative regulation of lipid catabolic process
GO:0010903 IDA:BHF-UCL P negative regulation of very-low-density lipoprotein particle remodeling
GO:0031100 IEA:Ensembl P organ regeneration
GO:0018206 IDA:UniProtKB P peptidyl-methionine modification
GO:0006656 IDA:BHF-UCL P phosphatidylcholine biosynthetic process
GO:0009395 IDA:BHF-UCL P phospholipid catabolic process
GO:0033700 IDA:BHF-UCL P phospholipid efflux
GO:0007603 TAS:Reactome P phototransduction, visible light
GO:0043085 IDA:GOC P positive regulation of catalytic activity
GO:0010873 IDA:BHF-UCL P positive regulation of cholesterol esterification
GO:0045416 IDA:UniProtKB P positive regulation of interleukin-8 biosynthetic process
GO:0050996 IDA:BHF-UCL P positive regulation of lipid catabolic process
GO:0006457 IDA:BHF-UCL P protein folding
GO:0018158 IDA:UniProtKB P protein oxidation
GO:0030300 IEA:Ensembl P regulation of intestinal cholesterol absorption
GO:0031647 IDA:BHF-UCL P regulation of protein stability
GO:0042493 IEA:Ensembl P response to drug
GO:0043627 IEA:Ensembl P response to estrogen
GO:0051384 IEA:Ensembl P response to glucocorticoid
GO:0009749 IDA:BHF-UCL P response to glucose
GO:0001523 TAS:Reactome P retinoid metabolic process
GO:0043691 IDA:BHF-UCL P reverse cholesterol transport
GO:0044281 TAS:Reactome P small molecule metabolic process
GO:0006641 TAS:BHF-UCL P triglyceride metabolic process
GO:0034370 IDA:BHF-UCL P triglyceride-rich lipoprotein particle remodeling
GO:0016032 IEA:UniProtKB-KW P viral process

KEGG Pathway Links

KEGG Pathway ID Description
hsa03320 PPAR signaling pathway

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_116145 PPARA activates gene expression

Domain Information

InterPro Annotations

Accession Description
IPR006801 Apolipoprotein A-II (ApoA-II)

UniProt Annotations

Entry Information

Gene Name
apolipoprotein A-II
Protein Entry
APOA2_HUMAN
UniProt ID
P02652
Species
Human

Comments

Comment Type Description
Function May stabilize HDL (high density lipoprotein) structure by its association with lipids, and affect the HDL metabolism.
Mass Spectrometry Mass=17166.2; Method=MALDI; Range=24-99; Note=Homodimer.; Evidence= ;
Mass Spectrometry Mass=17252; Method=Electrospray; Range=24-100; Note=Homodimer, without methionine sulfoxide.; Evidence= ;
Mass Spectrometry Mass=17269; Method=Electrospray; Range=24-100; Note=Homodimer, with 1 methionine sulfoxide, oxidation at Met-49.; Evidence= ;
Mass Spectrometry Mass=17293.4; Method=MALDI; Range=24-100; Note=Heterodimer with truncated apolipoprotein A-II.; Evidence= ;
Mass Spectrometry Mass=17421.3; Method=MALDI; Range=24-100; Note=Homodimer.; Evidence= ;
Mass Spectrometry Mass=8578.3; Method=MALDI; Range=24-99; Evidence= ;
Mass Spectrometry Mass=8701.2; Method=MALDI; Range=24-100; Evidence= ;
Mass Spectrometry Mass=8823.4; Method=MALDI; Range=24-100; Note=Cysteinylated ApoA-II.; Evidence= ;
Polymorphism A homozygous transition at position 1 of intron 3 of APOA2 results in deficiency of apolipoprotein A-II, without significant influence either on lipid and lipoprotein profiles or on the occurrence of coronary artery disease [MIM
Ptm Apolipoprotein A-II is O-glycosylated.
Ptm Phosphorylation sites are present in the extracellular medium.
Similarity Belongs to the apolipoprotein A2 family.
Subcellular Location Secreted.
Subunit Homodimer; disulfide-linked. Also forms a disulfide- linked heterodimer with APOD. Interacts with HCV core protein. Interacts with APOA1BP and NDRG1. {ECO
Tissue Specificity Plasma; synthesized in the liver and intestine.
Web Resource Name=SHMPD; Note=The Singapore human mutation and polymorphism database; URL="http://shmpd.bii.a-star.edu.sg/gene.php?genestart=A&genename=APOA2";

Identical and Related Proteins

Unique RefSeq proteins for LMP000398 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
4502149 RefSeq NP_001634 100 apolipoprotein A-II preproprotein

Identical Sequences to LMP000398 proteins

Reference Database Accession Length Protein Name
GI:4502149 GenBank AGM57155.1 100 Sequence 171 from patent US 8420337
GI:4502149 GenBank AGP16939.1 100 Sequence 2 from patent US 8460889
GI:4502149 GenBank AHE01108.1 100 Sequence 56024 from patent US 8586006
GI:4502149 GenBank AIC48277.1 100 APOA2, partial [synthetic construct]
GI:4502149 RefSeq XP_004027815.1 100 PREDICTED: apolipoprotein A-II [Gorilla gorilla gorilla]
GI:4502149 RefSeq XP_004027816.1 100 PREDICTED: apolipoprotein A-II [Gorilla gorilla gorilla]

Related Sequences to LMP000398 proteins

Reference Database Accession Length Protein Name
GI:4502149 GenBank AAP36148.1 101 Homo sapiens apolipoprotein A-II, partial [synthetic construct]
GI:4502149 GenBank AAX29455.1 101 apolipoprotein A-II, partial [synthetic construct]
GI:4502149 GenBank AAX29456.1 101 apolipoprotein A-II, partial [synthetic construct]
GI:4502149 GenBank AGB62517.1 153 Sequence 78 from patent US 8288091
GI:4502149 GenBank AGB62523.1 120 Sequence 84 from patent US 8288091
GI:4502149 RefSeq XP_004027817.1 133 PREDICTED: apolipoprotein A-II [Gorilla gorilla gorilla]