Gene/Proteome Database (LMPD)

LMPD ID
LMP000373
Gene ID
Species
Mus musculus (Mouse)
Gene Name
cytochrome b5 type A (microsomal)
Gene Symbol
Synonyms
0610009N12Rik; Cyb5
Alternate Names
cytochrome b5; cytochrome b-5
Chromosome
18
Map Location
18 E4|18 57.53 cM

Proteins

cytochrome b5
Refseq ID NP_080073
Protein GI 13385268
UniProt ID P56395
mRNA ID NM_025797
Length 134
RefSeq Status PROVISIONAL
MAGQSDKDVKYYTLEEIQKHKDSKSTWVILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDARELSKTYIIGELHPDDRSKIAKPSDTLITTVESNSSWWTNWVIPAISALAVALMYRLYMAED

Gene Information

Entrez Gene ID
Gene Name
cytochrome b5 type A (microsomal)
Gene Symbol
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IEA:UniProtKB-KW C endoplasmic reticulum
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0016020 ISO:MGI C membrane
GO:0005739 IDA:MGI C mitochondrion
GO:0020037 IEA:InterPro F heme binding
GO:0046872 IEA:UniProtKB-KW F metal ion binding
GO:0004768 TAS:MGI F stearoyl-CoA 9-desaturase activity
GO:0006631 IC:MGI P fatty acid metabolic process

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY-5996 oleate biosynthesis II (animals)

REACTOME Pathway Links

REACTOME Pathway ID Description
5892801 Metabolism of water-soluble vitamins and cofactors
5893519 Vitamin C (ascorbate) metabolism

Domain Information

InterPro Annotations

Accession Description
IPR018506 Cytochrome b5, heme-binding site
IPR001199 Cytochrome b5-like heme/steroid binding domain

UniProt Annotations

Entry Information

Gene Name
cytochrome b5 type A (microsomal)
Protein Entry
CYB5_MOUSE
UniProt ID
Species
Mouse

Comments

Comment Type Description
Function Cytochrome b5 is a membrane bound hemoprotein which function as an electron carrier for several membrane bound oxygenases. It is also involved in several steps of the sterol biosynthesis pathway, particularly in the C-5 double bond introduction during the C-5 desaturation.
Similarity Belongs to the cytochrome b5 family. {ECO:0000305}.
Similarity Contains 1 cytochrome b5 heme-binding domain. {ECO:0000255|PROSITE-ProRule:PRU00279}.
Subcellular Location Endoplasmic reticulum membrane {ECO:0000250}; Single-pass membrane protein {ECO:0000250}; Cytoplasmic side {ECO:0000250}. Microsome membrane {ECO:0000250}; Single-pass membrane protein {ECO:0000250}; Cytoplasmic side {ECO:0000250}.

Identical and Related Proteins

Unique RefSeq proteins for LMP000373 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
13385268 RefSeq NP_080073 134 cytochrome b5

Identical Sequences to LMP000373 proteins

Reference Database Accession Length Protein Name
GI:13385268 DBBJ BAB22093.1 134 unnamed protein product [Mus musculus]
GI:13385268 DBBJ BAB28714.1 134 unnamed protein product [Mus musculus]
GI:13385268 DBBJ BAE20982.1 134 unnamed protein product [Mus musculus]
GI:13385268 GenBank AAH24341.1 134 Cytochrome b-5 [Mus musculus]
GI:13385268 GenBank EDL09355.1 134 cytochrome b-5, isoform CRA_d [Mus musculus]
GI:13385268 SwissProt P56395.2 134 RecName: Full=Cytochrome b5 [Mus musculus]

Related Sequences to LMP000373 proteins

Reference Database Accession Length Protein Name
GI:13385268 DBBJ BAA02492.1 134 cytochrome b5 precursor [Rattus norvegicus]
GI:13385268 GenBank EDL75181.1 134 cytochrome b-5, isoform CRA_d [Rattus norvegicus]
GI:13385268 GenBank AFO15775.1 134 Sequence 24 from patent US 8211998
GI:13385268 RefSeq NP_071581.1 134 cytochrome b5 [Rattus norvegicus]
GI:13385268 RefSeq XP_003512427.1 134 PREDICTED: cytochrome b5 [Cricetulus griseus]
GI:13385268 RefSeq XP_007612552.1 134 PREDICTED: cytochrome b5 [Cricetulus griseus]