Gene/Proteome Database (LMPD)

LMPD ID
LMP000371
Gene ID
15496
Species
Mus musculus (Mouse)
Gene Name
hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 5
Gene Symbol
Hsd3b5
Synonyms
-
Alternate Names
3 beta-hydroxysteroid dehydrogenase type 5; 3(beta)HSDV; 3-beta-HSD V; progesterone reductase; 3 beta-hydroxysteroid dehydrogenase type V; 3-beta-hydroxy-5-ene steroid dehydrogenase; hydroxysteroid dehydrogenase-5, delta<5>-3-beta; NADPH-dependent 3-beta-hydroxy-Delta(5)-steroid dehydrogenase
Chromosome
3
Map Location
3 F2.2|3
EC Number
1.1.1.-

Proteins

3 beta-hydroxysteroid dehydrogenase type 5
Refseq ID NP_032321
Protein GI 113680667
UniProt ID Q61694
mRNA ID NM_008295
Length 373
RefSeq Status VALIDATED
MPGWSCLVTGAGGFLGQRIVRMLVQEEELQEIRALFRTFGRKHEEELSKLQTKAKVRVLKGDILDAQCLKRACQGMSAVIHTAAAIDPLGAASRQTILDVNLKGTQLLLDACVEASVPTFIYSSSVLVAGPNSYKEIILNAHEEEHRESTWPNPYPYSKRMAEKAVLATNGRLLKNGGTLHTCALRLPFIYGEECQVTSTTVKTALKNNSIIKKNATFSIANPVYVGNAAWAHILAARSLQDPKKSPSIQGQFYYISDNTPHQSYDDLNYTLSKEWGLCLDSGWSLPLSLLYWLAFLLETVSFLLRPVYNYRPPFNRLLITVLNSVFTISYKKAQRDLGYQPLVSWEEAKQKTSEWIGTLVKQHRETLHKKSQ

Gene Information

Entrez Gene ID
15496
Gene Name
hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 5
Gene Symbol
Hsd3b5
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IEA:UniProtKB-KW C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005743 IDA:MGI C mitochondrial inner membrane
GO:0005739 IDA:MGI C mitochondrion
GO:0003854 IEA:InterPro F 3-beta-hydroxy-delta5-steroid dehydrogenase activity
GO:0035634 IEP:UniProtKB P response to stilbenoid
GO:0006694 IEA:UniProtKB-UniPathway P steroid biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
mmu04913 Ovarian steroidogenesis
mmu00140 Steroid hormone biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR002225 3-beta hydroxysteroid dehydrogenase/isomerase
IPR016040 NAD(P)-binding domain

UniProt Annotations

Entry Information

Gene Name
hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 5
Protein Entry
3BHS5_MOUSE
UniProt ID
Q61694
Species
Mouse

Comments

Comment Type Description
Catalytic Activity 3-beta-hydroxy-Delta(5)-steroid + NADP(+) = 3- oxo-Delta(5)-steroid + NADPH.
Function The 3-beta-HSD enzymatic system plays a crucial role in the biosynthesis of all classes of hormonal steroids. HSD V can only catalyze the conversion of dihydrotestosterone to 5 alpha- androstanediol in the presence of the cofactor NADPH. Does not function as a isomerase.
Pathway Lipid metabolism; steroid biosynthesis.
Similarity Belongs to the 3-beta-HSD family. {ECO:0000305}.
Subcellular Location Endoplasmic reticulum membrane; Single-pass membrane protein. Mitochondrion membrane; Single-pass membrane protein.
Tissue Specificity Expressed in the male liver, starting in late puberty.

Identical and Related Proteins

Unique RefSeq proteins for LMP000371 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
113680667 RefSeq NP_032321 373 3 beta-hydroxysteroid dehydrogenase type 5

Identical Sequences to LMP000371 proteins

Reference Database Accession Length Protein Name
GI:113680667 GenBank AAH12715.1 373 Hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 5 [Mus musculus]
GI:113680667 GenBank EDL38964.1 373 mCG20398 [Mus musculus]
GI:113680667 SwissProt Q61694.4 373 RecName: Full=3 beta-hydroxysteroid dehydrogenase type 5; AltName: Full=3 beta-hydroxysteroid dehydrogenase type V; Short=3-beta-HSD V; AltName: Full=3-beta-hydroxy-5-ene steroid dehydrogenase; AltName: Full=NADPH-dependent 3-beta-hydroxy-Delta(5)-steroid dehydrogenase; AltName: Full=Progesterone reductase [Mus musculus]

Related Sequences to LMP000371 proteins

Reference Database Accession Length Protein Name
GI:113680667 GenBank AAA39374.1 373 3-beta-hydroxysteroid dehydrogenase/delta-5-delta-4-isomerase [Mus musculus]
GI:113680667 GenBank AAB81242.1 373 3-ketosteroid reductase [Mus musculus domesticus]
GI:113680667 GenBank AAI32403.1 373 Hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 4 [Mus musculus]
GI:113680667 GenBank AEW41339.1 373 Sequence 3 from patent US 8076102
GI:113680667 RefSeq NP_032320.1 373 3 beta-hydroxysteroid dehydrogenase type 4 [Mus musculus]
GI:113680667 SwissProt Q61767.3 373 RecName: Full=3 beta-hydroxysteroid dehydrogenase type 4; AltName: Full=3 beta-hydroxysteroid dehydrogenase type IV; Short=3-beta-HSD IV; AltName: Full=3-beta-hydroxy-5-ene steroid dehydrogenase; AltName: Full=NADPH-dependent 3-beta-hydroxy-Delta(5)-steroid dehydrogenase; AltName: Full=Progesterone reductase [Mus musculus]