LIPID MAPS

LMPD ID

LMP000352

Gene ID

5564

Species

Homo sapiens (Human)

Gene Name

protein kinase, AMP-activated, beta 1 non-catalytic subunit

Gene Symbol

PRKAB1

Synonyms

AMPK; HAMPKb

Alternate Names

5'-AMP-activated protein kinase subunit beta-1;,AMPKb; AMPK beta 1; AMPK beta -1 chain; AMPK subunit beta-1; AMP-activated protein kinase beta subunit', "5'-AMP-activated protein kinase beta-1 subunit;,protein kinase, AMP-activated, noncatalytic, beta-1

Chromosome

12

Map Location

12q24.1-q24.3

Summary

The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This subunit may be a positive regulator of AMPK activity. The myristoylation and phosphorylation of this subunit have been shown to affect the enzyme activity and cellular localization of AMPK. This subunit may also serve as an adaptor molecule mediating the association of the AMPK complex. [provided by RefSeq, Jul 2008]

Orthologs

View orthologs and multiple alignments for PRKAB1

5'-AMP-activated protein kinase subunit beta-1
Refseq ID	NP_006244
Protein GI	19923359
UniProt ID	Q9Y478
mRNA ID	NM_006253
Length	270
RefSeq Status	REVIEWED
MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVNDKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSHNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELSSSPPGPYHQEPYVCKPEERFRAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI

Entrez Gene ID

5564

Gene Name

protein kinase, AMP-activated, beta 1 non-catalytic subunit

Gene Symbol

PRKAB1

Species

Homo sapiens

Gene Ontology (GO Annotations)

GO ID	Source	Type	Description
GO:0031588	IEA:Ensembl	C	AMP-activated protein kinase complex
GO:0005829	TAS:Reactome	C	cytosol
GO:0005634	IEA:Ensembl	C	nucleus
GO:0004672	IDA:UniProtKB	F	protein kinase activity
GO:0007050	TAS:Reactome	P	cell cycle arrest
GO:0006633	IEA:UniProtKB-KW	P	fatty acid biosynthetic process
GO:0008286	TAS:Reactome	P	insulin receptor signaling pathway
GO:0061024	TAS:Reactome	P	membrane organization
GO:0010628	IDA:UniProtKB	P	positive regulation of gene expression
GO:0051291	IEA:Ensembl	P	protein heterooligomerization
GO:0006468	IDA:UniProtKB	P	protein phosphorylation
GO:0050790	IEA:Ensembl	P	regulation of catalytic activity
GO:0007165	TAS:ProtInc	P	signal transduction

KEGG Pathway Links

KEGG Pathway ID	Description
hsa04152	AMPK signaling pathway
hsa04068	FoxO signaling pathway
hsa04932	Non-alcoholic fatty liver disease (NAFLD)
hsa04921	Oxytocin signaling pathway

InterPro Annotations

Accession	Description
IPR006828	Association with the SNF1 complex (ASC) domain
IPR014756	Immunoglobulin E-set

Entry Information

Gene Name

protein kinase, AMP-activated, beta 1 non-catalytic subunit

Protein Entry

AAKB1_HUMAN

UniProt ID

Q9Y478

Species

Human

Comments

Comment Type	Description
Domain	The glycogen-binding domain may target AMPK to glycogen so that other factors like glycogen-bound debranching enzyme or protein phosphatases can directly affect AMPK activity.
Function	Non-catalytic subunit of AMP-activated protein kinase (AMPK), an energy sensor protein kinase that plays a key role in regulating cellular energy metabolism. In response to reduction of intracellular ATP levels, AMPK activates energy-producing pathways and inhibits energy-consuming processes: inhibits protein, carbohydrate and lipid biosynthesis, as well as cell growth and proliferation. AMPK acts via direct phosphorylation of metabolic enzymes, and by longer-term effects via phosphorylation of transcription regulators. Also acts as a regulator of cellular polarity by remodeling the actin cytoskeleton; probably by indirectly activating myosin. Beta non-catalytic subunit acts as a scaffold on which the AMPK complex assembles, via its C-terminus that bridges alpha (PRKAA1 or PRKAA2) and gamma subunits (PRKAG1, PRKAG2 or PRKAG3).
Interaction	O70302:Cidea (xeno); NbExp=4; IntAct=EBI-719769, EBI-7927848; P62993:GRB2; NbExp=2; IntAct=EBI-719769, EBI-401755; Q13131:PRKAA1; NbExp=5; IntAct=EBI-719769, EBI-1181405; P54619:PRKAG1; NbExp=4; IntAct=EBI-719769, EBI-1181439;
Ptm	Phosphorylated when associated with the catalytic subunit (PRKAA1 or PRKAA2). Phosphorylated by ULK1; leading to negatively regulate AMPK activity and suggesting the existence of a regulatory feedback loop between ULK1 and AMPK. {ECO
Sequence Caution	Sequence=AAB71326.1; Type=Erroneous gene model prediction; Evidence= ; Sequence=AAC98897.1; Type=Frameshift; Positions=245; Evidence= ;
Similarity	Belongs to the 5'-AMP-activated protein kinase beta subunit family.
Subunit	AMPK is a heterotrimer of an alpha catalytic subunit (PRKAA1 or PRKAA2), a beta (PRKAB1 or PRKAB2) and a gamma non- catalytic subunits (PRKAG1, PRKAG2 or PRKAG3). Interacts with FNIP1 and FNIP2. {ECO
Web Resource	Name=Atlas of Genetics and Cytogenetics in Oncology and Haematology; URL="http://atlasgeneticsoncology.org/Genes/PRKAB1ID44100ch12q24.html";

Unique RefSeq proteins for LMP000352 (as displayed in Record Overview)

Protein GI	Database	Accession	Length	Protein Name
19923359	RefSeq	NP_006244	270	5'-AMP-activated protein kinase subunit beta-1

Identical Sequences to LMP000352 proteins

Reference	Database	Accession	Length	Protein Name
GI:19923359	GenBank	AHD69912.1	270	Sequence 1501 from patent US 8586006
GI:19923359	GenBank	AIC49469.1	270	PRKAB1, partial [synthetic construct]
GI:19923359	RefSeq	XP_005572434.1	270	PREDICTED: 5'-AMP-activated protein kinase subunit beta-1 isoform X1 [Macaca fascicularis]
GI:19923359	RefSeq	XP_008003095.1	270	PREDICTED: 5'-AMP-activated protein kinase subunit beta-1 isoform X1 [Chlorocebus sabaeus]
GI:19923359	RefSeq	XP_008956042.1	270	PREDICTED: 5'-AMP-activated protein kinase subunit beta-1 [Pan paniscus]
GI:19923359	RefSeq	XP_009424498.1	270	PREDICTED: 5'-AMP-activated protein kinase subunit beta-1 isoform X1 [Pan troglodytes]

Related Sequences to LMP000352 proteins

Reference	Database	Accession	Length	Protein Name
GI:19923359	GenBank	ACM82906.1	297	Sequence 8404 from patent US 6812339
GI:19923359	PDB	4CFE	286	Chain D, Structure Of Full Length Human Ampk In Complex With A Small Molecule Activator, A Benzimidazole Derivative (991)
GI:19923359	PDB	4CFF	286	Chain B, Structure Of Full Length Human Ampk In Complex With A Small Molecule Activator, A Thienopyridone Derivative (a-769662)
GI:19923359	PDB	4CFF	286	Chain D, Structure Of Full Length Human Ampk In Complex With A Small Molecule Activator, A Thienopyridone Derivative (a-769662)
GI:19923359	RefSeq	XP_003789975.1	270	PREDICTED: 5'-AMP-activated protein kinase subunit beta-1 [Otolemur garnettii]
GI:19923359	RefSeq	XP_010366576.1	270	PREDICTED: 5'-AMP-activated protein kinase subunit beta-1 isoform X1 [Rhinopithecus roxellana]