Gene/Proteome Database (LMPD)
LMPD ID
LMP000349
Gene ID
Species
Homo sapiens (Human)
Gene Name
nuclear receptor subfamily 1, group I, member 2
Gene Symbol
Synonyms
BXR; ONR1; PAR; PAR1; PAR2; PARq; PRR; PXR; SAR; SXR
Chromosome
3
Map Location
3q12-q13.3
Summary
This gene product belongs to the nuclear receptor superfamily, members of which are transcription factors characterized by a ligand-binding domain and a DNA-binding domain. The encoded protein is a transcriptional regulator of the cytochrome P450 gene CYP3A4, binding to the response element of the CYP3A4 promoter as a heterodimer with the 9-cis retinoic acid receptor RXR. It is activated by a range of compounds that induce CYP3A4, including dexamethasone and rifampicin. Several alternatively spliced transcripts encoding different isoforms, some of which use non-AUG (CUG) translation initiation codon, have been described for this gene. Additional transcript variants exist, however, they have not been fully characterized. [provided by RefSeq, Jul 2008]
Orthologs
Proteins
| nuclear receptor subfamily 1 group I member 2 isoform 1 | |
|---|---|
| Refseq ID | NP_003880 |
| Protein GI | 34398348 |
| UniProt ID | O75469 |
| mRNA ID | NM_003889 |
| Length | 434 |
| RefSeq Status | REVIEWED |
| MEVRPKESWNHADFVHCEDTESVPGKPSVNADEEVGGPQICRVCGDKATGYHFNVMTCEGCKGFFRRAMKRNARLRCPFRKGACEITRKTRRQCQACRLRKCLESGMKKEMIMSDEAVEERRALIKRKKSERTGTQPLGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVLSSGCELPESLQAPSREEAAKWSQVRKDLCSLKVSLQLRGEDGSVWNYKPPADSGGKEIFSLLPHMADMSTYMFKGIISFAKVISYFRDLPIEDQISLLKGAAFELCQLRFNTVFNAETGTWECGRLSYCLEDTAGGFQQLLLEPMLKFHYMLKKLQLHEEEYVLMQAISLFSPDRPGVLQHRVVDQLQEQFAITLKSYIECNRPQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPFATPLMQELFGITGS | |
| nuclear receptor subfamily 1 group I member 2 isoform 2 | |
|---|---|
| Refseq ID | NP_071285 |
| Protein GI | 11863132 |
| UniProt ID | O75469 |
| mRNA ID | NM_022002 |
| Length | 473 |
| RefSeq Status | REVIEWED |
| MTVTRTHHFKEGSLRAPAIPLHSAAAELASNHPRGPEANLEVRPKESWNHADFVHCEDTESVPGKPSVNADEEVGGPQICRVCGDKATGYHFNVMTCEGCKGFFRRAMKRNARLRCPFRKGACEITRKTRRQCQACRLRKCLESGMKKEMIMSDEAVEERRALIKRKKSERTGTQPLGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVLSSGCELPESLQAPSREEAAKWSQVRKDLCSLKVSLQLRGEDGSVWNYKPPADSGGKEIFSLLPHMADMSTYMFKGIISFAKVISYFRDLPIEDQISLLKGAAFELCQLRFNTVFNAETGTWECGRLSYCLEDTAGGFQQLLLEPMLKFHYMLKKLQLHEEEYVLMQAISLFSPDRPGVLQHRVVDQLQEQFAITLKSYIECNRPQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPFATPLMQELFGITGS | |
| nuclear receptor subfamily 1 group I member 2 isoform 3 | |
|---|---|
| Refseq ID | NP_148934 |
| Protein GI | 14702164 |
| UniProt ID | O75469 |
| mRNA ID | NM_033013 |
| Length | 397 |
| RefSeq Status | REVIEWED |
| MEVRPKESWNHADFVHCEDTESVPGKPSVNADEEVGGPQICRVCGDKATGYHFNVMTCEGCKGFFRRAMKRNARLRCPFRKGACEITRKTRRQCQACRLRKCLESGMKKEMIMSDEAVEERRALIKRKKSERTGTQPLGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRVSLQLRGEDGSVWNYKPPADSGGKEIFSLLPHMADMSTYMFKGIISFAKVISYFRDLPIEDQISLLKGAAFELCQLRFNTVFNAETGTWECGRLSYCLEDTAGGFQQLLLEPMLKFHYMLKKLQLHEEEYVLMQAISLFSPDRPGVLQHRVVDQLQEQFAITLKSYIECNRPQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPFATPLMQELFGITGS | |
Gene Information
Entrez Gene ID
Gene Name
nuclear receptor subfamily 1, group I, member 2
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005654 | TAS:Reactome | C | nucleoplasm |
| GO:0000977 | IDA:NTNU_SB | F | RNA polymerase II regulatory region sequence-specific DNA binding |
| GO:0001228 | IDA:NTNU_SB | F | RNA polymerase II transcription regulatory region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription |
| GO:0008144 | IDA:UniProtKB | F | drug binding |
| GO:0004879 | IDA:UniProtKB | F | ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity |
| GO:0003707 | IEA:InterPro | F | steroid hormone receptor activity |
| GO:0003713 | TAS:ProtInc | F | transcription coactivator activity |
| GO:0008270 | IEA:InterPro | F | zinc ion binding |
| GO:0046618 | IDA:UniProtKB | P | drug export |
| GO:0042738 | IDA:UniProtKB | P | exogenous drug catabolic process |
| GO:0010467 | TAS:Reactome | P | gene expression |
| GO:0030522 | IDA:GOC | P | intracellular receptor signaling pathway |
| GO:0045892 | IDA:MGI | P | negative regulation of transcription, DNA-templated |
| GO:0045944 | IDA:NTNU_SB | P | positive regulation of transcription from RNA polymerase II promoter |
| GO:0045893 | IDA:UniProtKB | P | positive regulation of transcription, DNA-templated |
| GO:0007165 | TAS:ProtInc | P | signal transduction |
| GO:0008202 | TAS:ProtInc | P | steroid metabolic process |
| GO:0006367 | TAS:Reactome | P | transcription initiation from RNA polymerase II promoter |
| GO:0006805 | IDA:UniProtKB | P | xenobiotic metabolic process |
| GO:0042908 | IDA:UniProtKB | P | xenobiotic transport |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_15525 | Nuclear Receptor transcription pathway |
Domain Information
UniProt Annotations
Entry Information
Gene Name
nuclear receptor subfamily 1, group I, member 2
Protein Entry
NR1I2_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=7; Name=1A; Synonyms=1, PRR1-A; IsoId=O75469-1; Sequence=Displayed; Name=1B; Synonyms=PRR1-B; IsoId=O75469-2; Sequence=VSP_003668; Name=1C; Synonyms=PRR1-C; IsoId=O75469-3; Sequence=VSP_003667; Name=2A; Synonyms=2, PRR2-A; IsoId=O75469-4; Sequence=VSP_003669; Name=2B; Synonyms=PRR2-B; IsoId=O75469-5; Sequence=VSP_003668, VSP_003669; Name=2C; Synonyms=PRR2-C; IsoId=O75469-6; Sequence=VSP_003667, VSP_003669; Name=3; IsoId=O75469-7; Sequence=VSP_026669; |
| Function | Nuclear receptor that binds and is activated by variety of endogenous and xenobiotic compounds. Transcription factor that activates the transcription of multiple genes involved in the metabolism and secretion of potentially harmful xenobiotics, drugs and endogenous compounds. Activated by the antibiotic rifampicin and various plant metabolites, such as hyperforin, guggulipid, colupulone, and isoflavones. Response to specific ligands is species-specific. Activated by naturally occurring steroids, such as pregnenolone and progesterone. Binds to a response element in the promoters of the CYP3A4 and ABCB1/MDR1 genes. {ECO |
| Interaction | P08238:HSP90AB1; NbExp=2; IntAct=EBI-3905991, EBI-352572; |
| Similarity | Belongs to the nuclear hormone receptor family. NR1 subfamily. |
| Similarity | Contains 1 nuclear receptor DNA-binding domain. |
| Subcellular Location | Nucleus {ECO |
| Subunit | Heterodimer with RXR. Interacts with NCOA1. {ECO |
| Tissue Specificity | Expressed in liver, colon and small intestine. |
| Web Resource | Name=SeattleSNPs; URL="http://pga.gs.washington.edu/data/nr1i2/"; |
Identical and Related Proteins
Unique RefSeq proteins for LMP000349 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 34398348 | RefSeq | NP_003880 | 434 | nuclear receptor subfamily 1 group I member 2 isoform 1 |
| 11863132 | RefSeq | NP_071285 | 473 | nuclear receptor subfamily 1 group I member 2 isoform 2 |
| 14702164 | RefSeq | NP_148934 | 397 | nuclear receptor subfamily 1 group I member 2 isoform 3 |
Identical Sequences to LMP000349 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:11863132 | DBBJ | BAI46174.1 | 473 | nuclear receptor subfamily 1, group I, member 2, partial [synthetic construct] |
| GI:14702164 | GenBank | AAK38721.1 | 397 | orphan nuclear receptor PXR.2 [Homo sapiens] |
| GI:34398348 | GenBank | ABJ52965.1 | 434 | orphan nuclear receptor [Homo sapiens] |
| GI:14702164 | GenBank | ABJ52966.1 | 397 | orphan nuclear receptor [Homo sapiens] |
| GI:34398348 | GenBank | ABL12766.1 | 434 | Sequence 2 from patent US 7118885 |
| GI:11863132 | GenBank | ABL12767.1 | 473 | Sequence 4 from patent US 7118885 |
| GI:11863132 | GenBank | EAW79538.1 | 473 | nuclear receptor subfamily 1, group I, member 2, isoform CRA_b [Homo sapiens] |
| GI:11863132 | GenBank | ABR09276.1 | 473 | nuclear receptor subfamily 1, group I, member 2 [Homo sapiens] |
| GI:11863132 | GenBank | ADZ17348.1 | 473 | pregnane X nuclear receptor variant 2 [Homo sapiens] |
| GI:34398348 | GenBank | AEK13588.1 | 434 | Sequence 2 from patent US 7972782 |
| GI:34398348 | GenBank | AER79658.1 | 434 | Sequence 1 from patent US 8048663 |
| GI:34398348 | GenBank | AEW40333.1 | 434 | Sequence 203 from patent US 8071291 |
| GI:14702164 | GenBank | AEW40334.1 | 397 | Sequence 204 from patent US 8071291 |
| GI:34398348 | GenBank | AHD78572.1 | 434 | Sequence 26570 from patent US 8586006 |
| GI:11863132 | GenBank | AHD78573.1 | 473 | Sequence 26571 from patent US 8586006 |
| GI:14702164 | GenBank | AHD78574.1 | 397 | Sequence 26572 from patent US 8586006 |
Related Sequences to LMP000349 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:34398348 | DBBJ | BAI46174.1 | 473 | nuclear receptor subfamily 1, group I, member 2, partial [synthetic construct] |
| GI:14702164 | EMBL | CAB55492.1 | 397 | nuclear hormone receptor PRR2-A [Homo sapiens] |
| GI:14702164 | EMBL | CAB55493.1 | 420 | nuclear hormone receptor PRR2-C [Homo sapiens] |
| GI:34398348 | GenBank | AAC64557.1 | 473 | orphan nuclear receptor [Homo sapiens] |
| GI:34398348 | GenBank | AAK38722.1 | 473 | orphan nuclear receptor PAR2 [Homo sapiens] |
| GI:14702164 | GenBank | EAW79539.1 | 397 | nuclear receptor subfamily 1, group I, member 2, isoform CRA_c, partial [Homo sapiens] |
| GI:14702164 | GenBank | AAH17304.2 | 433 | NR1I2 protein [Homo sapiens] |
| GI:34398348 | GenBank | ABR09276.1 | 473 | nuclear receptor subfamily 1, group I, member 2 [Homo sapiens] |
| GI:11863132 | GenBank | ACM82015.1 | 484 | Sequence 7513 from patent US 6812339 |
| GI:11863132 | GenBank | ACM82016.1 | 484 | Sequence 7514 from patent US 6812339 |
| GI:11863132 | GenBank | ACM82017.1 | 484 | Sequence 7515 from patent US 6812339 |
| GI:34398348 | GenBank | ADZ17348.1 | 473 | pregnane X nuclear receptor variant 2 [Homo sapiens] |
| GI:11863132 | GenBank | ADZ17384.1 | 470 | pregnane X nuclear receptor [Homo sapiens] |
| GI:14702164 | GenBank | AED70872.1 | 397 | Sequence 29 from patent US 7910303 |
| GI:14702164 | GenBank | AFQ69644.1 | 397 | Sequence 29 from patent US 8227189 |
| GI:34398348 | RefSeq | NP_071285.1 | 473 | nuclear receptor subfamily 1 group I member 2 isoform 2 [Homo sapiens] |
| GI:11863132 | RefSeq | XP_001164074.1 | 473 | PREDICTED: nuclear receptor subfamily 1 group I member 2 isoform X3 [Pan troglodytes] |
| GI:11863132 | RefSeq | XP_004036179.1 | 473 | PREDICTED: nuclear receptor subfamily 1 group I member 2 isoform 1 [Gorilla gorilla gorilla] |