Gene/Proteome Database (LMPD)
LMPD ID
LMP000328
Gene ID
Species
Mus musculus (Mouse)
Gene Name
sterol carrier protein 2, liver
Gene Symbol
Synonyms
AA409774; AA409893; C76618; C79031; NSL-TP; SCP-2; SCP-X; SCPX; ns-LTP
Alternate Names
non-specific lipid-transfer protein; SCP-chi; sterol carrier protein X; propanoyl-CoA C-acyltransferase; nonspecific lipid transfer protein
Chromosome
4
Map Location
4 C7|4 50.2 cM
EC Number
2.3.1.176
Proteins
| non-specific lipid-transfer protein | |
|---|---|
| Refseq ID | NP_035457 |
| Protein GI | 45476581 |
| UniProt ID | P32020 |
| mRNA ID | NM_011327 |
| Length | 547 |
| RefSeq Status | VALIDATED |
| MPSVALKSPRLRRVFVVGVGMTKFMKPGGENSRDYPDMAKEAGQKALEDAQIPYSAVEQACVGYVYGDSTSGQRAIYHSLGLTGIPIINVNNNCSTGSTALFMAHQLIQGGLANCVLALGFEKMERGSIGTKFSDRTTPTDKHIEVLIDKYGLSAHPITPQMFGYAGKEHMEKYGTKVEHFAKIGWKNHKHSVNNTYSQFQDEYSLEEVMKSKPVFDFLTILQCCPTSDGAAAAILSSEEFVQQYGLQSKAVEIVAQEMMTDLPSTFEEKSIIKVVGYDMSKEAARRCYEKSGLTPNDVDVIELHDCFSVNELITYEALGLCPEGQGGTLVDRGDNTYGGKWVINPSGGLISKGHPLGATGLAQCAELCWQLRGEAGKRQVPGAKVALQHNLGLGGAVVVTLYRMGFPEAASSFRTHQVSAAPTSSAGDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSDKKADCTITMADSDLLALMTGKMNPQSAFFQGKLKIAGNMGLAMKLQNLQLQPGKAKL | |
Gene Information
Entrez Gene ID
Gene Name
sterol carrier protein 2, liver
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0070062 | IEA:Ensembl | C | extracellular vesicular exosome |
| GO:0005739 | IDA:MGI | C | mitochondrion |
| GO:0005634 | IEA:Ensembl | C | nucleus |
| GO:0005777 | TAS:MGI | C | peroxisome |
| GO:0043234 | IEA:Ensembl | C | protein complex |
| GO:0015485 | IEA:Ensembl | F | cholesterol binding |
| GO:0036042 | IEA:Ensembl | F | long-chain fatty acyl-CoA binding |
| GO:0070538 | IEA:Ensembl | F | oleic acid binding |
| GO:0008526 | IEA:Ensembl | F | phosphatidylinositol transporter activity |
| GO:0033814 | IEA:UniProtKB-EC | F | propanoyl-CoA C-acyltransferase activity |
| GO:0050632 | TAS:MGI | F | propionyl-CoA C2-trimethyltridecanoyltransferase activity |
| GO:0006637 | TAS:MGI | P | acyl-CoA metabolic process |
| GO:0032959 | IEA:Ensembl | P | inositol trisphosphate biosynthetic process |
| GO:1901373 | IEA:Ensembl | P | lipid hydroperoxide transport |
| GO:0007031 | IMP:MGI | P | peroxisome organization |
| GO:0032385 | IEA:Ensembl | P | positive regulation of intracellular cholesterol transport |
| GO:0045940 | IEA:Ensembl | P | positive regulation of steroid metabolic process |
| GO:0006701 | IEA:Ensembl | P | progesterone biosynthetic process |
| GO:0072659 | IEA:Ensembl | P | protein localization to plasma membrane |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative initiation; Named isoforms=2; Name=SCPx; IsoId=P32020-1; Sequence=Displayed; Name=SCP2; IsoId=P32020-2; Sequence=VSP_018895; Note=Mitochondrial precursor. Contains a mitochondrial transit peptide at positions 405-424 (Potential). {ECO:0000305}; |
| Catalytic Activity | 3-alpha,7-alpha,12-alpha-trihydroxy-5-beta- cholanoyl-CoA + propanoyl-CoA = CoA + 3-alpha,7-alpha,12-alpha- trihydroxy-24-oxo-5-beta-cholestanoyl-CoA. |
| Function | Mediates in vitro the transfer of all common phospholipids, cholesterol and gangliosides between membranes. May play a role in regulating steroidogenesis. |
| Similarity | Contains 1 SCP2 domain. {ECO:0000305}. |
| Similarity | In the N-terminal section; belongs to the thiolase family. {ECO:0000305}. |
| Subcellular Location | Cytoplasm. Note=Cytoplasmic in the liver and also associated with mitochondria especially in steroidogenic tissues. |
| Subcellular Location | Isoform SCP2: Mitochondrion. |
| Subcellular Location | Isoform SCPx: Peroxisome. Note=Interaction with PEX5 is essential for peroxisomal import. {ECO:0000250}. |
| Subunit | Interacts with PEX5. {ECO:0000250}. |
| Tissue Specificity | Present at low levels in all tissues examined but expressed predominantly in the liver. |
Identical and Related Proteins
Unique RefSeq proteins for LMP000328 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 45476581 | RefSeq | NP_035457 | 547 | non-specific lipid-transfer protein |
Identical Sequences to LMP000328 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:45476581 | GenBank | AAH18384.1 | 547 | Sterol carrier protein 2, liver [Mus musculus] |
| GI:45476581 | GenBank | AAH34613.1 | 547 | Sterol carrier protein 2, liver [Mus musculus] |
| GI:45476581 | SwissProt | P32020.3 | 547 | RecName: Full=Non-specific lipid-transfer protein; Short=NSL-TP; AltName: Full=Propanoyl-CoA C-acyltransferase; AltName: Full=SCP-chi; AltName: Full=SCPX; AltName: Full=Sterol carrier protein 2; Short=SCP-2; AltName: Full=Sterol carrier protein X; Short=SCP-X [Mus musculus] |
Related Sequences to LMP000328 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:45476581 | GenBank | AAA40098.1 | 547 | sterol-carrier protein X [Mus musculus] |
| GI:45476581 | GenBank | EDL30752.1 | 534 | mCG126417, isoform CRA_a [Mus musculus] |
| GI:45476581 | GenBank | EDL30755.1 | 531 | mCG126417, isoform CRA_d [Mus musculus] |
| GI:45476581 | GenBank | EGV97950.1 | 547 | Non-specific lipid-transfer protein [Cricetulus griseus] |
| GI:45476581 | RefSeq | XP_003496559.1 | 547 | PREDICTED: non-specific lipid-transfer protein [Cricetulus griseus] |
| GI:45476581 | RefSeq | XP_007611057.1 | 547 | PREDICTED: non-specific lipid-transfer protein [Cricetulus griseus] |