Gene/Proteome Database (LMPD)
LMPD ID
LMP000320
Gene ID
Species
Mus musculus (Mouse)
Gene Name
diacylglycerol O-acyltransferase 2
Gene Symbol
Synonyms
0610010B06Rik; ARAT; DGAT-2
Alternate Names
diacylglycerol O-acyltransferase 2; diglyceride acyltransferase 2; retinol O-fatty-acyltransferase; diacylglycerol acyltransferase 2; acyl-CoA retinol O-fatty-acyltransferase
Chromosome
7
Map Location
7|7 F1
EC Number
2.3.1.20
Proteins
| diacylglycerol O-acyltransferase 2 | |
|---|---|
| Refseq ID | NP_080660 |
| Protein GI | 16975490 |
| UniProt ID | Q9DCV3 |
| mRNA ID | NM_026384 |
| Length | 388 |
| RefSeq Status | PROVISIONAL |
| MKTLIAAYSGVLRGERRAEAARSENKNKGSALSREGSGRWGTGSSILSALQDIFSVTWLNRSKVEKQLQVISVLQWVLSFLVLGVACSVILMYTFCTDCWLIAVLYFTWLAFDWNTPKKGGRRSQWVRNWAVWRYFRDYFPIQLVKTHNLLTTRNYIFGYHPHGIMGLGAFCNFSTEATEVSKKFPGIRPYLATLAGNFRMPVLREYLMSGGICPVNRDTIDYLLSKNGSGNAIIIVVGGAAESLSSMPGKNAVTLKNRKGFVKLALRHGADLVPTYSFGENEVYKQVIFEEGSWGRWVQKKFQKYIGFAPCIFHGRGLFSSDTWGLVPYSKPITTVVGEPITVPKLEHPTQKDIDLYHAMYMEALVKLFDNHKTKFGLPETEVLEVN | |
Gene Information
Entrez Gene ID
Gene Name
diacylglycerol O-acyltransferase 2
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IDA:BHF-UCL | C | endoplasmic reticulum |
| GO:0030176 | IDA:BHF-UCL | C | integral component of endoplasmic reticulum membrane |
| GO:0016021 | IDA:MGI | C | integral component of membrane |
| GO:0005811 | IEA:UniProtKB-KW | C | lipid particle |
| GO:0016020 | IDA:MGI | C | membrane |
| GO:0048471 | IDA:BHF-UCL | C | perinuclear region of cytoplasm |
| GO:0003846 | IDA:MGI | F | 2-acylglycerol O-acyltransferase activity |
| GO:0004144 | ISS:UniProtKB | F | diacylglycerol O-acyltransferase activity |
| GO:0042803 | IPI:BHF-UCL | F | protein homodimerization activity |
| GO:0050252 | IEA:UniProtKB-EC | F | retinol O-fatty-acyltransferase activity |
| GO:0071400 | IMP:BHF-UCL | P | cellular response to oleic acid |
| GO:0035356 | IMP:BHF-UCL | P | cellular triglyceride homeostasis |
| GO:0042632 | IMP:BHF-UCL | P | cholesterol homeostasis |
| GO:0046339 | IDA:BHF-UCL | P | diacylglycerol metabolic process |
| GO:0060613 | IMP:BHF-UCL | P | fat pad development |
| GO:0055089 | IGI:BHF-UCL | P | fatty acid homeostasis |
| GO:0006071 | IEA:UniProtKB-KW | P | glycerol metabolic process |
| GO:0019915 | IMP:BHF-UCL | P | lipid storage |
| GO:0035336 | IDA:BHF-UCL | P | long-chain fatty-acyl-CoA metabolic process |
| GO:0034383 | IMP:BHF-UCL | P | low-density lipoprotein particle clearance |
| GO:0097006 | IMP:BHF-UCL | P | regulation of plasma lipoprotein particle levels |
| GO:0019432 | ISS:UniProtKB | P | triglyceride biosynthetic process |
KEGG Pathway Links
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| 5893976 | Acyl chain remodeling of DAG and TAG |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR007130 | Diacylglycerol acyltransferase |
UniProt Annotations
Entry Information
Gene Name
diacylglycerol O-acyltransferase 2
Protein Entry
DGAT2_MOUSE
UniProt ID
Species
Mouse
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Acyl-CoA + 1,2-diacylglycerol = CoA + triacylglycerol. |
| Catalytic Activity | Acyl-CoA + retinol = CoA + retinyl ester. |
| Disruption Phenotype | Mice are lipopenic and die soon after birth, apparently from profound reductions in substrates for energy metabolism and from impaired permeability barrier function in the skin. {ECO:0000269|PubMed:14668353}. |
| Enzyme Regulation | Inhibited by niacin. {ECO:0000250}. |
| Function | Essential acyltransferase that catalyzes the terminal and only committed step in triacylglycerol synthesis by using diacylglycerol and fatty acyl CoA as substrates. Required for synthesis and storage of intracellular triglycerides. Probably plays a central role in cytosolic lipid accumulation. In liver, is primarily responsible for incorporating endogenously synthesized fatty acids into triglycerides. Functions also as an acyl-CoA retinol acyltransferase (ARAT) (By similarity). {ECO:0000250}. |
| Induction | In white adipose tissue, it is regulated by leptin. By insulin. Up-regulated in diabetic mice. Down-regulated upon fasting and replenished upon refeeding in adipose tissue and liver. Down-regulation in obese animals can reduce hepatic lipogenesis and hepatic steatosis as well as attenuate hyperlipidemia, thereby leading to an improvement in metabolic syndrome. {ECO:0000269|PubMed:12413942, ECO:0000269|PubMed:14521909, ECO:0000269|PubMed:16001399}. |
| Pathway | Glycerolipid metabolism; triacylglycerol biosynthesis. |
| Similarity | Belongs to the diacylglycerol acyltransferase family. {ECO:0000305}. |
| Subcellular Location | Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. Lipid droplet {ECO:0000250}. |
| Subunit | Forms multimeric complexes consisting of several DGAT2 subunits. {ECO:0000250}. |
| Tissue Specificity | Predominantly expressed in liver. Also expressed in testis. {ECO:0000269|PubMed:11481335}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP000320 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 16975490 | RefSeq | NP_080660 | 388 | diacylglycerol O-acyltransferase 2 |
Identical Sequences to LMP000320 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:16975490 | GenBank | ADR90376.1 | 388 | Sequence 98 from patent US 7741532 |
| GI:16975490 | GenBank | ADR90382.1 | 388 | Sequence 127 from patent US 7741532 |
| GI:16975490 | GenBank | AED72408.1 | 388 | Sequence 12 from patent US 7910346 |
| GI:16975490 | GenBank | AGC98167.1 | 388 | Sequence 12 from patent US 8334111 |
| GI:16975490 | GenBank | AGX59587.1 | 388 | Sequence 19453 from patent US 8541208 |
| GI:16975490 | GenBank | AGX72252.1 | 388 | Sequence 44303 from patent US 8541208 |
Related Sequences to LMP000320 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:16975490 | GenBank | AAH89846.1 | 388 | Diacylglycerol O-acyltransferase homolog 2 (mouse) [Rattus norvegicus] |
| GI:16975490 | RefSeq | NP_001012345.1 | 388 | diacylglycerol O-acyltransferase 2 [Rattus norvegicus] |
| GI:16975490 | RefSeq | XP_003507132.1 | 388 | PREDICTED: diacylglycerol O-acyltransferase 2 isoform X1 [Cricetulus griseus] |
| GI:16975490 | RefSeq | XP_006982228.1 | 388 | PREDICTED: diacylglycerol O-acyltransferase 2 isoform X1 [Peromyscus maniculatus bairdii] |
| GI:16975490 | RefSeq | XP_006982230.1 | 388 | PREDICTED: diacylglycerol O-acyltransferase 2 isoform X3 [Peromyscus maniculatus bairdii] |
| GI:16975490 | SwissProt | Q5FVP8.1 | 388 | RecName: Full=Diacylglycerol O-acyltransferase 2; AltName: Full=Acyl-CoA retinol O-fatty-acyltransferase; Short=ARAT; Short=Retinol O-fatty-acyltransferase; AltName: Full=Diglyceride acyltransferase 2 [Rattus norvegicus] |