Gene/Proteome Database (LMPD)
LMPD ID
LMP000295
Gene ID
Species
Mus musculus (Mouse)
Gene Name
phospholipase A2, group IB, pancreas
Gene Symbol
Synonyms
Pla2a; sPLA2IB
Alternate Names
phospholipase A2; PLA2-Ib; group IB phospholipase A2; phosphatidylcholine 2-acylhydrolase 1B
Chromosome
5
Map Location
5|5 F1-G1.1
EC Number
3.1.1.4
Proteins
| phospholipase A2 precursor | |
|---|---|
| Refseq ID | NP_035237 |
| Protein GI | 6755090 |
| UniProt ID | Q9Z0Y2 |
| mRNA ID | NM_011107 |
| Length | 146 |
| RefSeq Status | PROVISIONAL |
| MKLLLLAALLTAGAAAHSISPRAVWQFRNMIKCTIPGSDPLKDYNNYGCYCGLGGWGTPVDDLDRCCQTHDHCYSQAKKLESCKFLIDNPYTNTYSYSCSGSEITCSAKNNKCEDFICNCDREAAICFSKVPYNKEYKNLDTGKFC | |
| sig_peptide: 1..15 inference: non-experimental evidence, no additional details recorded note: By similarity; propagated from UniProtKB/Swiss-Prot (Q9Z0Y2.1) calculated_mol_wt: 1470 peptide sequence: MKLLLLAALLTAGAA mat_peptide: 23..146 product: Phospholipase A2 experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q9Z0Y2.1) calculated_mol_wt: 14089 peptide sequence: AVWQFRNMIKCTIPGSDPLKDYNNYGCYCGLGGWGTPVDDLDRCCQTHDHCYSQAKKLESCKFLIDNPYTNTYSYSCSGSEITCSAKNNKCEDFICNCDREAAICFSKVPYNKEYKNLDTGKFC | |
Gene Information
Entrez Gene ID
Gene Name
phospholipase A2, group IB, pancreas
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0009986 | IEA:Ensembl | C | cell surface |
| GO:0005576 | IDA:MGI | C | extracellular region |
| GO:0005615 | IEA:Ensembl | C | extracellular space |
| GO:0030141 | IEA:Ensembl | C | secretory granule |
| GO:0005509 | IEA:InterPro | F | calcium ion binding |
| GO:0047498 | IEA:Ensembl | F | calcium-dependent phospholipase A2 activity |
| GO:0004623 | IDA:MGI | F | phospholipase A2 activity |
| GO:0005102 | IDA:MGI | F | receptor binding |
| GO:0019731 | IEA:Ensembl | P | antibacterial humoral response |
| GO:0050830 | IEA:Ensembl | P | defense response to Gram-positive bacterium |
| GO:0006633 | IEA:Ensembl | P | fatty acid biosynthetic process |
| GO:0002227 | IEA:Ensembl | P | innate immune response in mucosa |
| GO:0044240 | IEA:Ensembl | P | multicellular organismal lipid catabolic process |
| GO:0046470 | IEA:Ensembl | P | phosphatidylcholine metabolic process |
| GO:0009395 | TAS:MGI | P | phospholipid catabolic process |
| GO:0045740 | IEA:Ensembl | P | positive regulation of DNA replication |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
phospholipase A2, group IB, pancreas
Protein Entry
PA21B_MOUSE
UniProt ID
Species
Mouse
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Phosphatidylcholine + H(2)O = 1- acylglycerophosphocholine + a carboxylate. {ECO:0000255|PROSITE- ProRule:PRU10035, ECO:0000255|PROSITE-ProRule:PRU10036}. |
| Cofactor | Name=Ca(2+); Xref=ChEBI:CHEBI:29108; Evidence={ECO:0000250}; Note=Binds 1 Ca(2+) ion per subunit. {ECO:0000250}; |
| Function | PA2 catalyzes the calcium-dependent hydrolysis of the 2- acyl groups in 3-sn-phosphoglycerides, this releases glycerophospholipids and arachidonic acid that serve as the precursors of signal molecules. |
| Ptm | Activated by trypsin cleavage in the duodenum. Can also be activated by thrombin or autocatalytically (By similarity). {ECO:0000250}. |
| Similarity | Belongs to the phospholipase A2 family. {ECO:0000305}. |
| Subcellular Location | Secreted. Note=secreted from pancreatic acinar cells in its inactive form. {ECO:0000250}. |
| Subunit | Monomer or homodimer. The inactive pro-form is a homotrimer (By similarity). {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP000295 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 6755090 | RefSeq | NP_035237 | 146 | phospholipase A2 precursor |
Identical Sequences to LMP000295 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:6755090 | DBBJ | BAC25763.1 | 146 | unnamed protein product [Mus musculus] |
| GI:6755090 | GenBank | EDL19858.1 | 146 | phospholipase A2, group IB, pancreas [Mus musculus] |
| GI:6755090 | GenBank | AAI45909.1 | 146 | Phospholipase A2, group IB, pancreas [Mus musculus] |
| GI:6755090 | GenBank | AAI45911.1 | 146 | Phospholipase A2, group IB, pancreas [Mus musculus] |
| GI:6755090 | GenBank | AEU43301.1 | 146 | Sequence 50 from patent US 8052970 |
| GI:6755090 | RefSeq | XP_006530261.1 | 146 | PREDICTED: phospholipase A2 isoform X1 [Mus musculus] |
Related Sequences to LMP000295 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:6755090 | DBBJ | BAB25608.1 | 146 | unnamed protein product [Mus musculus] |
| GI:6755090 | DBBJ | BAB26212.1 | 146 | unnamed protein product [Mus musculus] |
| GI:6755090 | GenBank | AAE33227.1 | 146 | Sequence 34 from patent US 5972677 |
| GI:6755090 | GenBank | EDM13879.1 | 146 | phospholipase A2, group IB, isoform CRA_b [Rattus norvegicus] |
| GI:6755090 | GenBank | AEU43283.1 | 146 | Sequence 32 from patent US 8052970 |
| GI:6755090 | RefSeq | XP_006530262.1 | 145 | PREDICTED: phospholipase A2 isoform X2 [Mus musculus] |