Gene/Proteome Database (LMPD)
Proteins
| membrane progestin receptor gamma | |
|---|---|
| Refseq ID | NP_083024 |
| Protein GI | 58037337 |
| UniProt ID | Q9DCU0 |
| mRNA ID | NM_028748 |
| Length | 330 |
| RefSeq Status | PROVISIONAL |
| MLSLKLPRLFRIDQVPQVFHEQGILFGYRHPQSSATACILSLFQMTNETLNIWTHLLPFWFFVWRFMTALYVTDIQNDSYSWPMLVYMCTSCVYPLASSCAHTFSSMSKNARHICYFLDYGAVNLFSLGSAIAYSAYTFPDALVCSTFHECYVALAVLNTILSTGLSCYSRFLELQKPRLCKLLRVLAFAYPYTWDSLPIFYRLFLFPGESSRNEAMLYHQKHMGMTLLASFFYSAHLPERLAPGRFDYIGHSHQLFHVCVILATHLQMEAILLDKTLRREWLLATSRPFSFPQIAAAMLLCIIFSLSNIIYFSAALYRIPEPELHEKET | |
Gene Information
Entrez Gene ID
Gene Name
progestin and adipoQ receptor family member V
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0004872 | IBA:RefGenome | F | receptor activity |
| GO:0005496 | IEA:UniProtKB-KW | F | steroid binding |
| GO:0007275 | IEA:UniProtKB-KW | P | multicellular organismal development |
| GO:0048477 | IEA:UniProtKB-KW | P | oogenesis |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR004254 | AdipoR/Haemolysin-III-related |
UniProt Annotations
Entry Information
Gene Name
progestin and adipoQ receptor family member V
Protein Entry
MPRG_MOUSE
UniProt ID
Species
Mouse
Comments
| Comment Type | Description |
|---|---|
| Function | Steroid membrane receptor. Binds progesterone. May be involved in oocyte maturation (By similarity). {ECO:0000250}. |
| Sequence Caution | Sequence=AAH54855.1; Type=Miscellaneous discrepancy; Note=Contaminating sequence. Potential poly-A sequence.; Evidence={ECO:0000305}; Sequence=BAC35142.1; Type=Erroneous initiation; Evidence={ECO:0000305}; |
| Similarity | Belongs to the ADIPOR family. {ECO:0000305}. |
| Subcellular Location | Membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP000288 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 58037337 | RefSeq | NP_083024 | 330 | membrane progestin receptor gamma |
Identical Sequences to LMP000288 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:58037337 | DBBJ | BAC29072.1 | 330 | unnamed protein product [Mus musculus] |
| GI:58037337 | DBBJ | BAC39443.1 | 330 | unnamed protein product [Mus musculus] |
| GI:58037337 | DBBJ | BAC39718.1 | 330 | unnamed protein product [Mus musculus] |
| GI:58037337 | GenBank | AAR08382.1 | 330 | progestin and adipoQ receptor family member V [Mus musculus] |
| GI:58037337 | GenBank | EDL26017.1 | 330 | progestin and adipoQ receptor family member V [Mus musculus] |
| GI:58037337 | SwissProt | Q9DCU0.1 | 330 | RecName: Full=Membrane progestin receptor gamma; Short=mPR gamma; AltName: Full=Progestin and adipoQ receptor family member V [Mus musculus] |
Related Sequences to LMP000288 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:58037337 | GenBank | AAH54855.1 | 348 | Paqr5 protein, partial [Mus musculus] |
| GI:58037337 | GenBank | AAH87040.1 | 330 | Progestin and adipoQ receptor family member V [Rattus norvegicus] |
| GI:58037337 | GenBank | EDL95744.1 | 330 | progestin and adipoQ receptor family member V [Rattus norvegicus] |
| GI:58037337 | RefSeq | NP_001014114.1 | 330 | membrane progestin receptor gamma [Rattus norvegicus] |
| GI:58037337 | RefSeq | XP_006243270.1 | 330 | PREDICTED: membrane progestin receptor gamma isoform X1 [Rattus norvegicus] |
| GI:58037337 | RefSeq | XP_008764497.1 | 330 | PREDICTED: membrane progestin receptor gamma isoform X1 [Rattus norvegicus] |