Gene/Proteome Database (LMPD)
LMPD ID
LMP000204
Gene ID
Species
Homo sapiens (Human)
Gene Name
phosphatidylinositol 4-kinase type 2 alpha
Gene Symbol
Synonyms
PI4KII; PIK42A
Alternate Names
phosphatidylinositol 4-kinase type 2-alpha; phosphatidylinositol 4-kinase type II-alpha; phosphatidylinositol 4-kinase type II (PI4KII)
Chromosome
10
Map Location
10q24
EC Number
2.7.1.67
Summary
Phosphatidylinositolpolyphosphates (PtdInsPs) are centrally involved in many biologic processes, ranging from cell growth and organization of the actin cytoskeleton to endo- and exocytosis. PI4KII phosphorylates PtdIns at the D-4 position, an essential step in the biosynthesis of PtdInsPs (Barylko et al., 2001 [PubMed 11244087]).[supplied by OMIM, Mar 2008]
Orthologs
Proteins
| phosphatidylinositol 4-kinase type 2-alpha | |
|---|---|
| Refseq ID | NP_060895 |
| Protein GI | 13559514 |
| UniProt ID | Q9BTU6 |
| mRNA ID | NM_018425 |
| Length | 479 |
| RefSeq Status | PROVISIONAL |
| MDETSPLVSPERAQPPDYTFPSGSGAHFPQVPGGAVRVAAAAGSGPSPPGSPGHDRERQPLLDRARGAAAQGQTQTVAAQAQALAAQAAAAAHAAQAHRERNEFPEDPEFEAVVRQAELAIERCIFPERIYQGSSGSYFVKDPQGRIIAVFKPKNEEPYGHLNPKWTKWLQKLCCPCCFGRDCLVLNQGYLSEAGASLVDQKLELNIVPRTKVVYLASETFNYSAIDRVKSRGKRLALEKVPKVGQRFNRIGLPPKVGSFQLFVEGYKDADYWLRRFEAEPLPENTNRQLLLQFERLVVLDYIIRNTDRGNDNWLIKYDCPMDSSSSRDTDWVVVKEPVIKVAAIDNGLAFPLKHPDSWRAYPFYWAWLPQAKVPFSQEIKDLILPKISDPNFVKDLEEDLYELFKKDPGFDRGQFHKQIAVMRGQILNLTQALKDNKSPLHLVQMPPVIVETARSHQRSSSESYTQSFQSRKPFFSWW | |
Gene Information
Entrez Gene ID
Gene Name
phosphatidylinositol 4-kinase type 2 alpha
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005794 | IEA:UniProtKB-KW | C | Golgi apparatus |
| GO:0030054 | IEA:UniProtKB-KW | C | cell junction |
| GO:0031410 | ISS:UniProtKB | C | cytoplasmic vesicle |
| GO:0005829 | TAS:Reactome | C | cytosol |
| GO:0030425 | ISS:UniProtKB | C | dendrite |
| GO:0031901 | IEA:Ensembl | C | early endosome membrane |
| GO:0005768 | ISS:UniProtKB | C | endosome |
| GO:0070382 | IEA:Ensembl | C | exocytic vesicle |
| GO:0035838 | ISS:UniProtKB | C | growing cell tip |
| GO:0044231 | ISS:UniProtKB | C | host cell presynaptic membrane |
| GO:0005887 | IDA:UniProtKB | C | integral component of plasma membrane |
| GO:0005765 | IDA:UniProtKB | C | lysosomal membrane |
| GO:0016020 | IDA:UniProtKB | C | membrane |
| GO:0045121 | IDA:UniProtKB | C | membrane raft |
| GO:0005739 | ISS:UniProtKB | C | mitochondrion |
| GO:0043005 | ISS:UniProtKB | C | neuron projection |
| GO:0043025 | ISS:UniProtKB | C | neuronal cell body |
| GO:0043204 | IEA:Ensembl | C | perikaryon |
| GO:0042734 | ISS:UniProtKB | C | presynaptic membrane |
| GO:0043234 | IEA:Ensembl | C | protein complex |
| GO:0030672 | IEA:Ensembl | C | synaptic vesicle membrane |
| GO:0004430 | IDA:UniProtKB | F | 1-phosphatidylinositol 4-kinase activity |
| GO:0035651 | IDA:UniProtKB | F | AP-3 adaptor complex binding |
| GO:0005524 | IEA:UniProtKB-KW | F | ATP binding |
| GO:0000287 | NAS:UniProtKB | F | magnesium ion binding |
| GO:0002561 | IEA:Ensembl | P | basophil degranulation |
| GO:0006661 | IDA:UniProtKB | P | phosphatidylinositol biosynthetic process |
| GO:0046854 | IDA:GOC | P | phosphatidylinositol phosphorylation |
| GO:0006644 | TAS:Reactome | P | phospholipid metabolic process |
| GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_120836 | Synthesis of PIPs at the Golgi membrane |
| REACT_120756 | Synthesis of PIPs at the early endosome membrane |
| REACT_121025 | Synthesis of PIPs at the plasma membrane |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR000403 | Phosphatidylinositol 3-/4-kinase, catalytic domain |
UniProt Annotations
Entry Information
Gene Name
phosphatidylinositol 4-kinase type 2 alpha
Protein Entry
P4K2A_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | ATP + 1-phosphatidyl-1D-myo-inositol = ADP + 1-phosphatidyl-1D-myo-inositol 4-phosphate. |
| Function | Together with PI4K2B and the type III PI4Ks (PIK4CA and PIK4CB) it contributes to the overall PI4-kinase activity of the cell. The phosphorylation of phosphatidylinositol (PI) to PI4P is the first committed step in the generation of phosphatidylinositol 4,5-bisphosphate (PIP2), a precursor of the second messenger inositol 1,4,5-trisphosphate (InsP3). Contributes to the production of InsP3 in stimulated cells (By similarity). This lipid kinase is the major phosphatidylinositol 4-phosphate (PI4P) producer in the Golgi apparatus, it generates more than 50% of this molecule which is essential for the identity of the organelle, protein sorting and membrane trafficking. |
| Interaction | Q96J02:ITCH; NbExp=5; IntAct=EBI-3239392, EBI-1564678; |
| Ptm | Palmitoylated by ZDHHC3 and ZDHHC7 in the CCPCC motif. Palmitoylation is cholesterol-dependent, and required for TGN localization. |
| Similarity | Belongs to the PI3/PI4-kinase family. Type II PI4K subfamily. |
| Similarity | Contains 1 PI3K/PI4K domain. |
| Subcellular Location | Cytoplasm. Golgi apparatus, trans-Golgi network membrane; Lipid-anchor. Membrane raft. Cell projection, dendrite . Cell junction, synapse, presynaptic cell membrane . Cell junction, synapse, synaptosome {ECO |
| Subunit | Associates with the BLOC-1 and the AP-3 complexes; the BLOC-1 complex is required for optimal binding of PI4K2A to the AP-3 complex. Interacts with BLOC1S5 and DTNBP1. Interacts with FOS; this interaction may enhance phosphatidylinositol phosphorylation activity (By similarity). |
| Tissue Specificity | Widely expressed. Highest expression is observed in kidney, brain, heart, skeletal muscle, and placenta and lowest expression is observed in colon, thymus, and small intestine. |
Identical and Related Proteins
Unique RefSeq proteins for LMP000204 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 13559514 | RefSeq | NP_060895 | 479 | phosphatidylinositol 4-kinase type 2-alpha |
Identical Sequences to LMP000204 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:13559514 | GenBank | JAA03802.1 | 479 | phosphatidylinositol 4-kinase type 2 alpha [Pan troglodytes] |
| GI:13559514 | GenBank | JAA13311.1 | 479 | phosphatidylinositol 4-kinase type 2 alpha [Pan troglodytes] |
| GI:13559514 | GenBank | JAA24907.1 | 479 | phosphatidylinositol 4-kinase type 2 alpha [Pan troglodytes] |
| GI:13559514 | GenBank | JAA40137.1 | 479 | phosphatidylinositol 4-kinase type 2 alpha [Pan troglodytes] |
| GI:13559514 | RefSeq | XP_004049954.1 | 479 | PREDICTED: phosphatidylinositol 4-kinase type 2-alpha [Gorilla gorilla gorilla] |
| GI:13559514 | RefSeq | XP_004093188.1 | 479 | PREDICTED: LOW QUALITY PROTEIN: phosphatidylinositol 4-kinase type 2-alpha [Nomascus leucogenys] |
Related Sequences to LMP000204 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:13559514 | GenBank | AAQ02479.1 | 480 | phosphatidylinositol 4-kinase type II, partial [synthetic construct] |
| GI:13559514 | GenBank | JAB17486.1 | 479 | phosphatidylinositol 4-kinase type 2-alpha [Callithrix jacchus] |
| GI:13559514 | GenBank | JAB33024.1 | 479 | phosphatidylinositol 4-kinase type 2-alpha [Callithrix jacchus] |
| GI:13559514 | RefSeq | XP_003904130.1 | 480 | PREDICTED: phosphatidylinositol 4-kinase type 2-alpha isoform X1 [Papio anubis] |
| GI:13559514 | RefSeq | XP_004749598.1 | 479 | PREDICTED: phosphatidylinositol 4-kinase type 2-alpha [Mustela putorius furo] |
| GI:13559514 | RefSeq | XP_005566180.1 | 480 | PREDICTED: phosphatidylinositol 4-kinase type 2-alpha isoform X1 [Macaca fascicularis] |