Gene/Proteome Database (LMPD)
Proteins
| NADH dehydrogenase subunit 2 (mitochondrion) | |
|---|---|
| Refseq ID | NP_904329 |
| Protein GI | 34538599 |
| UniProt ID | Q9MD59 |
| Length | 345 |
| RefSeq Status | REVIEWED |
| MNPITLAIIYFTIFLGPVITMSSTNLMLMWVGLEFSLLAIIPMLINKKNPRSTEAATKYFVTQATASMIILLAIVLNYKQLGTWMFQQQTNGLILNMTLMALSMKLGLAPFHFWLPEVTQGIPLHMGLILLTWQKIAPLSILIQIYPLLNSTIILMLAITSIFMGAWGGLNQTQMRKIMAYSSIAHMGWMLAILPYNPSLTLLNLMIYIILTAPMFMALMLNNSMTINSISLLWNKTPAMLTMISLMLLSLGGLPPLTGFLPKWIIITELMKNNCLIMATLMAMMALLNLFFYTRLIYSTSLTMFPTNNNSKMMTHQTKTKPNLMFSTLAIMSTMTLPLAPQLIT | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0005747 | IEA:Ensembl | C | mitochondrial respiratory chain complex I |
| GO:0005739 | IDA:MGI | C | mitochondrion |
| GO:0008137 | IEA:UniProtKB-EC | F | NADH dehydrogenase (ubiquinone) activity |
| GO:0006120 | IEA:InterPro | P | mitochondrial electron transport, NADH to ubiquinone |
| GO:0072593 | IDA:MGI | P | reactive oxygen species metabolic process |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | NADH + ubiquinone + 5 H(+)(In) = NAD(+) + ubiquinol + 4 H(+)(Out). {ECO:0000256|RuleBase:RU003403, ECO:0000256|SAAS:SAAS00093735}. |
| Function | Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. |
| Similarity | Belongs to the complex I subunit 2 family. |
| Subcellular Location | Mitochondrion inner membrane ; Multi-pass membrane protein {ECO:0000256|RuleBase:RU003403, ECO:0000256|SAAS:SAAS00093751}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP000200 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 34538599 | RefSeq | NP_904329 | 345 | NADH dehydrogenase subunit 2 (mitochondrion) |
Identical Sequences to LMP000200 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:34538599 | DBBJ | BAN16593.1 | 345 | NADH dehydrogenase subunit 2 (mitochondrion) [Mus musculus] |
| GI:34538599 | DBBJ | BAO42851.1 | 345 | NADH dehydrogenase subunit 2 (mitochondrion) [Mus musculus] |
| GI:34538599 | DBBJ | BAO42864.1 | 345 | NADH dehydrogenase subunit 2 (mitochondrion) [Mus musculus] |
| GI:34538599 | GenBank | AHI52058.1 | 345 | NADH dehydrogenase subunit 2 (mitochondrion) [Mus musculus domesticus] |
| GI:34538599 | GenBank | AHI52071.1 | 345 | NADH dehydrogenase subunit 2 (mitochondrion) [Mus musculus domesticus] |
| GI:34538599 | GenBank | AHI52084.1 | 345 | NADH dehydrogenase subunit 2 (mitochondrion) [Mus musculus domesticus] |
Related Sequences to LMP000200 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:34538599 | GenBank | AAS01427.1 | 345 | NADH dehydrogenase subunit 2 (mitochondrion) [Mus musculus] |
| GI:34538599 | GenBank | ABK79211.1 | 345 | NADH dehydrogenase subunit 2 (mitochondrion) [Mus musculus] |
| GI:34538599 | GenBank | ABK79276.1 | 345 | NADH dehydrogenase subunit 2 (mitochondrion) [Mus musculus domesticus] |
| GI:34538599 | GenBank | AGK29608.1 | 345 | NADH dehydrogenase subunit 2 (mitochondrion) [Mus musculus domesticus] |
| GI:34538599 | PRF | - | 345 | protein URF2 [Mus musculus] |
| GI:34538599 | SwissProt | P03893.1 | 345 | RecName: Full=NADH-ubiquinone oxidoreductase chain 2; AltName: Full=NADH dehydrogenase subunit 2 (mitochondrion) [Mus musculus] |