Gene/Proteome Database (LMPD)
Proteins
| biotin--protein ligase | |
|---|---|
| Refseq ID | NP_631884 |
| Protein GI | 20982837 |
| UniProt ID | Q3TZ03 |
| mRNA ID | NM_139145 |
| Length | 722 |
| RefSeq Status | PROVISIONAL |
| MEDRLQMDNGLIAQKIVSVHLKDPALKELGKASDKQVQGPPPGPEASPEAQPAQGVMEHAGQGDCKAAGEGPSPRRRGCAPESEPAADGDPGLSSPELCQLHLSICHECLELENSTIDSVRSASAENIPDLPCDHSGVEGAAGELCPERKGKRVNISGKAPNILLYVGSGSEEALGRLQQVRSVLTDCVDTDSYTLYHLLEDSALRDPWSDNCLLLVIASRDPIPKDIQHKFMAYLSQGGKVLGLSSPFTLGGFRVTRRDVLRNTVQNLVFSKADGTEVRLSVLSSGYVYEEGPSLGRLQGHLENEDKDKMIVHVPFGTLGGEAVLCQVHLELPPGASLVQTADDFNVLKSSNVRRHEVLKEILTALGLSCDAPQVPALTPLYLLLAAEETQDPFMQWLGRHTDPEGIIKSSKLSLQFVSSYTSEAEITPSSMPVVTDPEAFSSEHFSLETYRQNLQTTRLGKVILFAEVTSTTMSLLDGLMFEMPQEMGLIAIAVRQTQGKGRGPNAWLSPVGCALSTLLVFIPLRSQLGQRIPFVQHLMSLAVVEAVRSIPGYEDINLRVKWPNDIYYSDLMKIGGVLVNSTLMGETFYILIGCGFNVTNSNPTICINDLIEEHNKQHGAGLKPLRADCLIARAVTVLEKLIDRFQDQGPDGVLPLYYKYWVHGGQQVRLGSTEGPQASIVGLDDSGFLQVHQEDGGVVTVHPDGNSFDMLRNLIVPKRQ | |
Gene Information
Entrez Gene ID
Gene Name
holocarboxylase synthetase (biotin- [propriony-Coenzyme A-carboxylase (ATP-hydrolysing)] ligase)
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0000785 | IEA:Ensembl | C | chromatin |
| GO:0005829 | IEA:Ensembl | C | cytosol |
| GO:0005739 | IDA:MGI | C | mitochondrion |
| GO:0005652 | IEA:Ensembl | C | nuclear lamina |
| GO:0016363 | IEA:Ensembl | C | nuclear matrix |
| GO:0009374 | IEA:Ensembl | F | biotin binding |
| GO:0004077 | IEA:InterPro | F | biotin-[acetyl-CoA-carboxylase] ligase activity |
| GO:0004080 | IEA:Ensembl | F | biotin-[propionyl-CoA-carboxylase (ATP-hydrolyzing)] ligase activity |
| GO:0008283 | IEA:Ensembl | P | cell proliferation |
| GO:0071110 | IEA:Ensembl | P | histone biotinylation |
| GO:0070781 | IEA:Ensembl | P | response to biotin |
Domain Information
UniProt Annotations
Entry Information
Gene Name
holocarboxylase synthetase (biotin- [propriony-Coenzyme A-carboxylase (ATP-hydrolysing)] ligase)
Protein Entry
BPL1_MOUSE
UniProt ID
Species
Mouse
Identical and Related Proteins
Unique RefSeq proteins for LMP000177 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 20982837 | RefSeq | NP_631884 | 722 | biotin--protein ligase |
Identical Sequences to LMP000177 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:20982837 | DBBJ | BAE34407.1 | 722 | unnamed protein product [Mus musculus] |
| GI:20982837 | GenBank | AAH50090.1 | 722 | Holocarboxylase synthetase (biotin- [propriony-Coenzyme A-carboxylase (ATP-hydrolysing)] ligase) [Mus musculus] |
| GI:20982837 | GenBank | EDL03749.1 | 722 | holocarboxylase synthetase (biotin- [propriony-Coenzyme A-carboxylase (ATP-hydrolysing)] ligase), isoform CRA_a [Mus musculus] |
| GI:20982837 | RefSeq | XP_006522918.1 | 722 | PREDICTED: biotin--protein ligase isoform X6 [Mus musculus] |
| GI:20982837 | RefSeq | XP_006522919.1 | 722 | PREDICTED: biotin--protein ligase isoform X7 [Mus musculus] |
| GI:20982837 | SwissProt | Q920N2.1 | 722 | RecName: Full=Biotin--protein ligase; AltName: Full=Biotin apo-protein ligase; Includes: RecName: Full=Biotin--[methylmalonyl-CoA-carboxytransferase] ligase; Includes: RecName: Full=Biotin--[propionyl-CoA-carboxylase [ATP-hydrolyzing]] ligase; AltName: Full=Holocarboxylase synthetase; Short=HCS; Includes: RecName: Full=Biotin--[methylcrotonoyl-CoA-carboxylase] ligase; Includes: RecName: Full=Biotin--[acetyl-CoA-carboxylase] ligase [Mus musculus] |
Related Sequences to LMP000177 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:20982837 | GenBank | EDL76724.1 | 870 | similar to homolog of Human holocarboxylase synthetase gene HLCS (predicted) [Rattus norvegicus] |
| GI:20982837 | RefSeq | XP_006221149.1 | 870 | PREDICTED: biotin--protein ligase isoform X3 [Rattus norvegicus] |
| GI:20982837 | RefSeq | XP_006522913.1 | 1011 | PREDICTED: biotin--protein ligase isoform X1 [Mus musculus] |
| GI:20982837 | RefSeq | XP_006522914.1 | 881 | PREDICTED: biotin--protein ligase isoform X2 [Mus musculus] |
| GI:20982837 | RefSeq | XP_006522915.1 | 836 | PREDICTED: biotin--protein ligase isoform X3 [Mus musculus] |
| GI:20982837 | RefSeq | XP_008766833.1 | 870 | PREDICTED: biotin--protein ligase isoform X3 [Rattus norvegicus] |