Gene/Proteome Database (LMPD)
Proteins
| apolipoprotein A-II precursor | |
|---|---|
| Refseq ID | NP_038502 |
| Protein GI | 157951676 |
| UniProt ID | P09813 |
| mRNA ID | NM_013474 |
| Length | 102 |
| RefSeq Status | VALIDATED |
| MKLLAMVALLVTICSLEGALVKRQADGPDMQSLFTQYFQSMTDYGKDLMEKAKTSEIQSQAKAYFEKTHEQLTPLVRSAGTSLVNFFSSLMNLEEKPAPAAK | |
| sig_peptide: 1..18 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 1905 peptide sequence: MKLLAMVALLVTICSLEG mat_peptide: 24..102 product: Apolipoprotein A-II experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (P09813.2) calculated_mol_wt: 8854 peptide sequence: QADGPDMQSLFTQYFQSMTDYGKDLMEKAKTSEIQSQAKAYFEKTHEQLTPLVRSAGTSLVNFFSSLMNLEEKPAPAAK | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0072562 | IEA:Ensembl | C | blood microparticle |
| GO:0042627 | IEA:Ensembl | C | chylomicron |
| GO:0005829 | TAS:Reactome | C | cytosol |
| GO:0005576 | TAS:Reactome | C | extracellular region |
| GO:0005615 | IDA:MGI | C | extracellular space |
| GO:0070062 | IEA:Ensembl | C | extracellular vesicular exosome |
| GO:0034366 | IEA:Ensembl | C | spherical high-density lipoprotein particle |
| GO:0034361 | IEA:Ensembl | C | very-low-density lipoprotein particle |
| GO:0015485 | IEA:Ensembl | F | cholesterol binding |
| GO:0017127 | IEA:Ensembl | F | cholesterol transporter activity |
| GO:0008035 | IMP:MGI | F | high-density lipoprotein particle binding |
| GO:0055102 | IEA:Ensembl | F | lipase inhibitor activity |
| GO:0031210 | IEA:Ensembl | F | phosphatidylcholine binding |
| GO:0060228 | IEA:Ensembl | F | phosphatidylcholine-sterol O-acyltransferase activator activity |
| GO:0046982 | ISS:UniProtKB | F | protein heterodimerization activity |
| GO:0002526 | IEA:Ensembl | P | acute inflammatory response |
| GO:0015759 | NAS:UniProtKB | P | beta-glucoside transport |
| GO:0033344 | IEA:Ensembl | P | cholesterol efflux |
| GO:0042632 | IDA:MGI | P | cholesterol homeostasis |
| GO:0008203 | IMP:MGI | P | cholesterol metabolic process |
| GO:0046340 | IEA:Ensembl | P | diacylglycerol catabolic process |
| GO:0006631 | NAS:UniProtKB | P | fatty acid metabolic process |
| GO:0034380 | IEA:Ensembl | P | high-density lipoprotein particle assembly |
| GO:0034384 | IEA:Ensembl | P | high-density lipoprotein particle clearance |
| GO:0034375 | IEA:Ensembl | P | high-density lipoprotein particle remodeling |
| GO:0006869 | IMP:MGI | P | lipid transport |
| GO:0042157 | IDA:MGI | P | lipoprotein metabolic process |
| GO:0034374 | IEA:Ensembl | P | low-density lipoprotein particle remodeling |
| GO:0060621 | IEA:Ensembl | P | negative regulation of cholesterol import |
| GO:0060695 | IEA:Ensembl | P | negative regulation of cholesterol transporter activity |
| GO:0002740 | IEA:Ensembl | P | negative regulation of cytokine secretion involved in immune response |
| GO:0060192 | IMP:MGI | P | negative regulation of lipase activity |
| GO:0050995 | IEA:Ensembl | P | negative regulation of lipid catabolic process |
| GO:0010903 | IEA:Ensembl | P | negative regulation of very-low-density lipoprotein particle remodeling |
| GO:0031100 | IEA:Ensembl | P | organ regeneration |
| GO:0018206 | IEA:Ensembl | P | peptidyl-methionine modification |
| GO:0006656 | IEA:Ensembl | P | phosphatidylcholine biosynthetic process |
| GO:0009395 | IEA:Ensembl | P | phospholipid catabolic process |
| GO:0033700 | IEA:Ensembl | P | phospholipid efflux |
| GO:0010873 | IEA:Ensembl | P | positive regulation of cholesterol esterification |
| GO:0045416 | ISS:UniProtKB | P | positive regulation of interleukin-8 biosynthetic process |
| GO:0050996 | IEA:Ensembl | P | positive regulation of lipid catabolic process |
| GO:0006457 | IEA:Ensembl | P | protein folding |
| GO:0018158 | IEA:Ensembl | P | protein oxidation |
| GO:0030300 | IMP:MGI | P | regulation of intestinal cholesterol absorption |
| GO:0031647 | IEA:Ensembl | P | regulation of protein stability |
| GO:0042493 | IEA:Ensembl | P | response to drug |
| GO:0043627 | IEA:Ensembl | P | response to estrogen |
| GO:0051384 | IEA:Ensembl | P | response to glucocorticoid |
| GO:0009749 | IEA:Ensembl | P | response to glucose |
| GO:0043691 | IEA:Ensembl | P | reverse cholesterol transport |
| GO:0034370 | IEA:Ensembl | P | triglyceride-rich lipoprotein particle remodeling |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| mmu03320 | PPAR signaling pathway |
REACTOME Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR006801 | Apolipoprotein A-II (ApoA-II) |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Disease | Note=Defects in Apoa2 are the cause of senescence accelerated mouse (SAM), the senile amyloid is a mutated apolipoprotein A-II. |
| Function | May stabilize HDL (high density lipoprotein) structure by its association with lipids, and affect the HDL metabolism. |
| Mass Spectrometry | Mass=8709.2; Mass_error=0.071; Method=Electrospray; Range=24-102; Note=Strain C57BL/6. Without methionine sulfoxide.; Evidence={ECO:0000269|PubMed:16876491}; |
| Mass Spectrometry | Mass=8719.5; Method=Electrospray; Range=24-102; Note=Strain BALB/c. Without methionine sulfoxide.; Evidence={ECO:0000269|PubMed:16876491}; |
| Mass Spectrometry | Mass=8725.3; Mass_error=0.283; Method=Electrospray; Range=24-102; Note=Strain C57BL/6. With 1 methionine sulfoxide.; Evidence={ECO:0000269|PubMed:16876491}; |
| Mass Spectrometry | Mass=8735.2; Method=Electrospray; Range=24-102; Note=Strain BALB/c. With 1 methionine sulfoxide.; Evidence={ECO:0000269|PubMed:16876491}; |
| Mass Spectrometry | Mass=8742; Method=Electrospray; Range=24-102; Note=Strain C57BL/6. With 2 methionine sulfoxides.; Evidence={ECO:0000269|PubMed:16876491}; |
| Mass Spectrometry | Mass=9294; Mass_error=0.707; Method=Electrospray; Range=19-102; Note=Strain C57BL/6. Without methionine sulfoxide.; Evidence={ECO:0000269|PubMed:16876491}; |
| Mass Spectrometry | Mass=9304; Method=Electrospray; Range=19-102; Note=Strain BALB/c. Without methionine sulfoxide.; Evidence={ECO:0000269|PubMed:16876491}; |
| Miscellaneous | The apo A-II stoichiometry in HDL molecules varies among inbred mice strains, because of structural polymorphisms affecting the apo A-II gene, which influence its translational efficiency. |
| Miscellaneous | The sequence presented here is that of strain BALB/c and C3H/HeJ. |
| Ptm | Phosphorylation sites are present in the extracellular medium. {ECO:0000250}. |
| Similarity | Belongs to the apolipoprotein A2 family. {ECO:0000305}. |
| Subcellular Location | Secreted. |
| Subunit | Monomer. Interacts with APOA1BP and NDRG1 (By similarity). {ECO:0000250}. |
| Tissue Specificity | Plasma. |
Identical and Related Proteins
Unique RefSeq proteins for LMP000139 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 157951676 | RefSeq | NP_038502 | 102 | apolipoprotein A-II precursor |
Identical Sequences to LMP000139 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:157951676 | GenBank | EDL39118.1 | 102 | apolipoprotein A-II, isoform CRA_a [Mus musculus] |
| GI:157951676 | GenBank | EDL39119.1 | 102 | apolipoprotein A-II, isoform CRA_a [Mus musculus] |
| GI:157951676 | GenBank | EDL39120.1 | 102 | apolipoprotein A-II, isoform CRA_a [Mus musculus] |
| GI:157951676 | GenBank | EDL39121.1 | 102 | apolipoprotein A-II, isoform CRA_a [Mus musculus] |
| GI:157951676 | RefSeq | XP_006496688.1 | 102 | PREDICTED: apolipoprotein A-II isoform X1 [Mus musculus] |
| GI:157951676 | SwissProt | P09813.2 | 102 | RecName: Full=Apolipoprotein A-II; Short=Apo-AII; Short=ApoA-II; AltName: Full=Apolipoprotein A2; Contains: RecName: Full=Proapolipoprotein A-II; Short=ProapoA-II; Flags: Precursor [Mus musculus] |
Related Sequences to LMP000139 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:157951676 | EMBL | CAA27731.1 | 102 | unnamed protein product [Mus musculus] |
| GI:157951676 | EMBL | CAA44616.1 | 102 | apolipoprotein A-II [Mus musculus] |
| GI:157951676 | GenBank | AAA37250.1 | 102 | apolipoprotein A-II [Mus musculus domesticus] |
| GI:157951676 | GenBank | AAB35391.1 | 102 | APOAII [Mus musculus] |
| GI:157951676 | GenBank | AAH31786.1 | 102 | Apolipoprotein A-II [Mus musculus] |
| GI:157951676 | GenBank | ABV02576.1 | 102 | apolipoprotein A-II [Mus musculus] |