Gene/Proteome Database (LMPD)

LMPD ID
LMP000076
Gene ID
Species
Mus musculus (Mouse)
Gene Name
hydroxysteroid 11-beta dehydrogenase 2
Gene Symbol
Synonyms
11HSD2
Alternate Names
corticosteroid 11-beta-dehydrogenase isozyme 2; 11-DH2; 11-beta-HSD2; 11(beta)-HSD2; 11-beta-hydroxysteroid dehydrogenase type 2; NAD-dependent 11-beta-hydroxysteroid dehydrogenase
Chromosome
8
Map Location
8 D3|8 53.04 cM
EC Number
1.1.1.-

Proteins

corticosteroid 11-beta-dehydrogenase isozyme 2
Refseq ID NP_032315
Protein GI 133778913
UniProt ID P51661
mRNA ID NM_008289
Length 386
RefSeq Status VALIDATED
MERWPWPSGGAWLLVAARALLQLLRSDLRLGRPLLAALALLAALDWLCQRLLPPPAALVVLAGAGWIALSRLARPPRLPVATRAVLITGCDTGFGKETAKKLDAMGFTVLATVLDLNSPGALELRDLCSPRLKLLQMDLTKAEDISRVLEITKAHTASTGLWGLVNNAGLNIVVADVELSPVATFRKCMEVNFFGALELTKGLLPLLRHSRGRIVTVGSPAGDMPYPCLAAYGTSKAAIALLMDTFGCELLPWGIKVSIIKPGCFKTDAVTNVNLWEKRKQLLLANIPRELLQAYGEDYIEHVHGQFLNSLRMALPDLSPVVDAIIDALLAAQPRSRYYPGRGLGLMYFIHHYLPEGLRRCFLQNFFINHLLPRALRPGQHGPAPA

Gene Information

Entrez Gene ID
Gene Name
hydroxysteroid 11-beta dehydrogenase 2
Gene Symbol
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IEA:UniProtKB-KW C endoplasmic reticulum
GO:0003845 IEA:Ensembl F 11-beta-hydroxysteroid dehydrogenase [NAD(P)] activity
GO:0051287 IEA:Ensembl F NAD binding
GO:0005496 IEA:Ensembl F steroid binding
GO:0007565 IEA:Ensembl P female pregnancy
GO:0008211 IEA:Ensembl P glucocorticoid metabolic process
GO:0002017 IEA:Ensembl P regulation of blood volume by renal aldosterone
GO:0042493 IEA:Ensembl P response to drug
GO:0032094 IEA:Ensembl P response to food
GO:0051384 IEA:Ensembl P response to glucocorticoid
GO:0001666 IEA:Ensembl P response to hypoxia
GO:0032868 IEA:Ensembl P response to insulin

KEGG Pathway Links

KEGG Pathway ID Description
mmu04960 Aldosterone-regulated sodium reabsorption
mmu00140 Steroid hormone biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR002347 Glucose/ribitol dehydrogenase
IPR016040 NAD(P)-binding domain
IPR002198 Short-chain dehydrogenase/reductase SDR
IPR020904 Short-chain dehydrogenase/reductase, conserved site

UniProt Annotations

Entry Information

Gene Name
hydroxysteroid 11-beta dehydrogenase 2
Protein Entry
DHI2_MOUSE
UniProt ID
Species
Mouse

Comments

Comment Type Description
Catalytic Activity An 11-beta-hydroxysteroid + NAD(+) = an 11- oxosteroid + NADH.
Enzyme Regulation Inhibited by glycyrrhetinic acid, carbenoloxone and 11-alpha-OH-progesterone. {ECO:0000250}.
Function Catalyzes the conversion of cortisol to the inactive metabolite cortisone. Modulates intracellular glucocorticoid levels, thus protecting the nonselective mineralocorticoid receptor from occupation by glucocorticoids.
Sequence Caution Sequence=CAA62219.1; Type=Frameshift; Positions=383; Evidence={ECO:0000305};
Similarity Belongs to the short-chain dehydrogenases/reductases (SDR) family. {ECO:0000305}.
Subcellular Location Microsome. Endoplasmic reticulum {ECO:0000305}.
Subunit Interacts with ligand-free cytoplasmic NR3C2. {ECO:0000250}.
Tissue Specificity Highly expressed in kidney. Also found in colon and small intestine. Not expressed in the adrenal gland.

Identical and Related Proteins

Unique RefSeq proteins for LMP000076 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
133778913 RefSeq NP_032315 386 corticosteroid 11-beta-dehydrogenase isozyme 2

Identical Sequences to LMP000076 proteins

Reference Database Accession Length Protein Name
GI:133778913 GenBank AAH14753.1 386 Hsd11b2 protein [Mus musculus]
GI:133778913 GenBank EDL11285.1 386 hydroxysteroid 11-beta dehydrogenase 2 [Mus musculus]
GI:133778913 SwissProt P51661.2 386 RecName: Full=Corticosteroid 11-beta-dehydrogenase isozyme 2; AltName: Full=11-beta-hydroxysteroid dehydrogenase type 2; Short=11-DH2; Short=11-beta-HSD2; AltName: Full=NAD-dependent 11-beta-hydroxysteroid dehydrogenase [Mus musculus]

Related Sequences to LMP000076 proteins

Reference Database Accession Length Protein Name
GI:133778913 DBBJ BAE33080.1 386 unnamed protein product [Mus musculus]
GI:133778913 GenBank AAA87007.1 400 11-beta-hydroxylsteroid dehydrogenase type 2 [Rattus norvegicus]
GI:133778913 GenBank AAC60711.1 396 11 beta-hydroxysteroid dehydrogenase type 2 [Mus sp.]
GI:133778913 GenBank AAH66209.1 372 Hsd11b2 protein [Mus musculus]
GI:133778913 GenBank EDL92380.1 400 hydroxysteroid 11-beta dehydrogenase 2 [Rattus norvegicus]
GI:133778913 SwissProt P50233.1 400 RecName: Full=Corticosteroid 11-beta-dehydrogenase isozyme 2; AltName: Full=11-beta-hydroxysteroid dehydrogenase type 2; Short=11-DH2; Short=11-beta-HSD2; AltName: Full=NAD-dependent 11-beta-hydroxysteroid dehydrogenase [Rattus norvegicus]