Gene/Proteome Database (LMPD)
LMPD ID
LMP000054
Gene ID
Species
Homo sapiens (Human)
Gene Name
sterol O-acyltransferase 1
Gene Symbol
Synonyms
ACACT; ACAT; ACAT-1; ACAT1; SOAT; STAT
Alternate Names
sterol O-acyltransferase 1; acyl-coenzyme A:cholesterol acyltransferase 1; sterol O-acyltransferase (acyl-Coenzyme A: cholesterol acyltransferase) 1
Chromosome
1
Map Location
1q25
EC Number
2.3.1.26
Summary
The protein encoded by this gene belongs to the acyltransferase family. It is located in the endoplasmic reticulum, and catalyzes the formation of fatty acid-cholesterol esters. This gene has been implicated in the formation of beta-amyloid and atherosclerotic plaques by controlling the equilibrium between free cholesterol and cytoplasmic cholesteryl esters. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Nov 2011]
Orthologs
Proteins
| sterol O-acyltransferase 1 isoform 1 | |
|---|---|
| Refseq ID | NP_003092 |
| Protein GI | 49533617 |
| UniProt ID | P35610 |
| mRNA ID | NM_003101 |
| Length | 550 |
| RefSeq Status | REVIEWED |
| MVGEEKMSLRNRLSKSRENPEEDEDQRNPAKESLETPSNGRIDIKQLIAKKIKLTAEAEELKPFFMKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSVLEGEKNNHRAKDLRAPPEQGKIFIARRSLLDELLEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFSLLSYAFGKFPTVVWTWWIMFLSTFSVPYFLFQHWATGYSKSSHPLIRSLFHGFLFMIFQIGVLGFGPTYVVLAYTLPPASRFIIIFEQIRFVMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRNPTVRWGYVAMKFAQVFGCFFYVYYIFERLCAPLFRNIKQEPFSARVLVLCVFNSILPGVLILFLTFFAFLHCWLNAFAEMLRFGDRMFYKDWWNSTSYSNYYRTWNVVVHDWLYYYAYKDFLWFFSKRFKSAAMLAVFAVSAVVHEYALAVCLSFFYPVLFVLFMFFGMAFNFIVNDSRKKPIWNVLMWTSLFLGNGVLLCFYSQEWYARQHCPLKNPTFLDYVRPRSWTCRYVF | |
| sterol O-acyltransferase 1 isoform 2 | |
|---|---|
| Refseq ID | NP_001239440 |
| Protein GI | 357430782 |
| UniProt ID | P35610 |
| mRNA ID | NM_001252511 |
| Length | 492 |
| RefSeq Status | REVIEWED |
| MELKPFFMKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSVLEGEKNNHRAKDLRAPPEQGKIFIARRSLLDELLEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFSLLSYAFGKFPTVVWTWWIMFLSTFSVPYFLFQHWATGYSKSSHPLIRSLFHGFLFMIFQIGVLGFGPTYVVLAYTLPPASRFIIIFEQIRFVMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRNPTVRWGYVAMKFAQVFGCFFYVYYIFERLCAPLFRNIKQEPFSARVLVLCVFNSILPGVLILFLTFFAFLHCWLNAFAEMLRFGDRMFYKDWWNSTSYSNYYRTWNVVVHDWLYYYAYKDFLWFFSKRFKSAAMLAVFAVSAVVHEYALAVCLSFFYPVLFVLFMFFGMAFNFIVNDSRKKPIWNVLMWTSLFLGNGVLLCFYSQEWYARQHCPLKNPTFLDYVRPRSWTCRYVF | |
| sterol O-acyltransferase 1 isoform 3 | |
|---|---|
| Refseq ID | NP_001239441 |
| Protein GI | 357430784 |
| UniProt ID | P35610 |
| mRNA ID | NM_001252512 |
| Length | 485 |
| RefSeq Status | REVIEWED |
| MKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSVLEGEKNNHRAKDLRAPPEQGKIFIARRSLLDELLEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFSLLSYAFGKFPTVVWTWWIMFLSTFSVPYFLFQHWATGYSKSSHPLIRSLFHGFLFMIFQIGVLGFGPTYVVLAYTLPPASRFIIIFEQIRFVMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRNPTVRWGYVAMKFAQVFGCFFYVYYIFERLCAPLFRNIKQEPFSARVLVLCVFNSILPGVLILFLTFFAFLHCWLNAFAEMLRFGDRMFYKDWWNSTSYSNYYRTWNVVVHDWLYYYAYKDFLWFFSKRFKSAAMLAVFAVSAVVHEYALAVCLSFFYPVLFVLFMFFGMAFNFIVNDSRKKPIWNVLMWTSLFLGNGVLLCFYSQEWYARQHCPLKNPTFLDYVRPRSWTCRYVF | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IDA:BHF-UCL | C | endoplasmic reticulum |
| GO:0005789 | IDA:BHF-UCL | C | endoplasmic reticulum membrane |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0016020 | IDA:MGI | C | membrane |
| GO:0034736 | IDA:BHF-UCL | F | cholesterol O-acyltransferase activity |
| GO:0015485 | IDA:BHF-UCL | F | cholesterol binding |
| GO:0000062 | IDA:BHF-UCL | F | fatty-acyl-CoA binding |
| GO:0004772 | IMP:BHF-UCL | F | sterol O-acyltransferase activity |
| GO:0033344 | IMP:BHF-UCL | P | cholesterol efflux |
| GO:0034435 | IDA:BHF-UCL | P | cholesterol esterification |
| GO:0042632 | TAS:BHF-UCL | P | cholesterol homeostasis |
| GO:0008203 | IDA:BHF-UCL | P | cholesterol metabolic process |
| GO:0010878 | IMP:BHF-UCL | P | cholesterol storage |
| GO:0010742 | IMP:BHF-UCL | P | macrophage derived foam cell differentiation |
| GO:0042986 | IMP:BHF-UCL | P | positive regulation of amyloid precursor protein biosynthetic process |
| GO:0034379 | IMP:BHF-UCL | P | very-low-density lipoprotein particle assembly |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=P35610-1; Sequence=Displayed; Name=2; IsoId=P35610-2; Sequence=VSP_045331; Name=3; IsoId=P35610-3; Sequence=VSP_045330; |
| Catalytic Activity | Acyl-CoA + cholesterol = CoA + cholesterol ester. |
| Function | Catalyzes the formation of fatty acid-cholesterol esters, which are less soluble in membranes than cholesterol. Plays a role in lipoprotein assembly and dietary cholesterol absorption. In addition to its acyltransferase activity, it may act as a ligase. |
| Induction | Highly activated by the presence of cholesterol. |
| Interaction | Q9Y5Z9:UBIAD1; NbExp=3; IntAct=EBI-6621997, EBI-2819725; |
| Similarity | Belongs to the membrane-bound acyltransferase family. Sterol o-acyltransferase subfamily. |
| Subcellular Location | Endoplasmic reticulum membrane ; Multi-pass membrane protein . |
| Subunit | May form homo- or heterodimers. Interacts with UBIAD1. |
Identical and Related Proteins
Unique RefSeq proteins for LMP000054 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 49533617 | RefSeq | NP_003092 | 550 | sterol O-acyltransferase 1 isoform 1 |
| 357430782 | RefSeq | NP_001239440 | 492 | sterol O-acyltransferase 1 isoform 2 |
| 357430784 | RefSeq | NP_001239441 | 485 | sterol O-acyltransferase 1 isoform 3 |
Identical Sequences to LMP000054 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:357430782 | DBBJ | BAF83348.1 | 492 | unnamed protein product [Homo sapiens] |
| GI:357430784 | DBBJ | BAG62257.1 | 485 | unnamed protein product [Homo sapiens] |
| GI:357430784 | GenBank | EAW91043.1 | 485 | sterol O-acyltransferase (acyl-Coenzyme A: cholesterol acyltransferase) 1, isoform CRA_a [Homo sapiens] |
| GI:49533617 | GenBank | JAA08173.1 | 550 | sterol O-acyltransferase 1 [Pan troglodytes] |
| GI:49533617 | GenBank | JAA26481.1 | 550 | sterol O-acyltransferase 1 [Pan troglodytes] |
| GI:49533617 | GenBank | JAA41814.1 | 550 | sterol O-acyltransferase 1 [Pan troglodytes] |
| GI:49533617 | GenBank | AHD75002.1 | 550 | Sequence 15706 from patent US 8586006 |
| GI:49533617 | GenBank | AIC49768.1 | 550 | SOAT1, partial [synthetic construct] |
| GI:49533617 | RefSeq | XP_003824754.1 | 550 | PREDICTED: sterol O-acyltransferase 1 [Pan paniscus] |
| GI:357430784 | RefSeq | XP_004028024.1 | 485 | PREDICTED: sterol O-acyltransferase 1 isoform 1 [Gorilla gorilla gorilla] |
| GI:357430784 | RefSeq | XP_004028025.1 | 485 | PREDICTED: sterol O-acyltransferase 1 isoform 2 [Gorilla gorilla gorilla] |
Related Sequences to LMP000054 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:49533617 | GenBank | AAA95660.1 | 550 | Sequence 4 from patent US 5484727 |
| GI:49533617 | GenBank | AAC37532.2 | 550 | acyl-coenzyme A: cholesterol acyltransferase [Homo sapiens] |
| GI:49533617 | GenBank | AAE15377.1 | 550 | Sequence 4 from patent US 5834283 |
| GI:49533617 | GenBank | AAE31894.1 | 550 | Sequence 4 from patent US 5968749 |
| GI:49533617 | GenBank | ABM82733.1 | 550 | sterol O-acyltransferase (acyl-Coenzyme A: cholesterol acyltransferase) 1 [synthetic construct] |
| GI:357430784 | GenBank | ABM85917.1 | 550 | sterol O-acyltransferase (acyl-Coenzyme A: cholesterol acyltransferase) 1, partial [synthetic construct] |
| GI:357430782 | GenBank | ABM85917.1 | 550 | sterol O-acyltransferase (acyl-Coenzyme A: cholesterol acyltransferase) 1, partial [synthetic construct] |
| GI:357430784 | GenBank | JAA08173.1 | 550 | sterol O-acyltransferase 1 [Pan troglodytes] |
| GI:357430782 | GenBank | JAA08173.1 | 550 | sterol O-acyltransferase 1 [Pan troglodytes] |
| GI:357430782 | GenBank | JAA26481.1 | 550 | sterol O-acyltransferase 1 [Pan troglodytes] |
| GI:357430784 | GenBank | JAA26481.1 | 550 | sterol O-acyltransferase 1 [Pan troglodytes] |
| GI:357430782 | GenBank | JAA41814.1 | 550 | sterol O-acyltransferase 1 [Pan troglodytes] |
| GI:357430784 | GenBank | JAA41814.1 | 550 | sterol O-acyltransferase 1 [Pan troglodytes] |
| GI:49533617 | PRF | - | 550 | acyl-CoA/cholesterol acyltransferase [Homo sapiens] |
| GI:357430784 | RefSeq | XP_003824754.1 | 550 | PREDICTED: sterol O-acyltransferase 1 [Pan paniscus] |
| GI:357430782 | RefSeq | XP_003824754.1 | 550 | PREDICTED: sterol O-acyltransferase 1 [Pan paniscus] |
| GI:357430782 | SwissProt | P35610.3 | 550 | RecName: Full=Sterol O-acyltransferase 1; AltName: Full=Acyl-coenzyme A:cholesterol acyltransferase 1; Short=ACAT-1; AltName: Full=Cholesterol acyltransferase 1 [Homo sapiens] |
| GI:357430784 | SwissProt | P35610.3 | 550 | RecName: Full=Sterol O-acyltransferase 1; AltName: Full=Acyl-coenzyme A:cholesterol acyltransferase 1; Short=ACAT-1; AltName: Full=Cholesterol acyltransferase 1 [Homo sapiens] |