LMPD Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
LMP013304

Record overview

LMPD IDLMP013304
Gene ID309004
SpeciesMacaca mulata (Rhesus monkey)
Gene Namevitamin K epoxide reductase complex, subunit 1
Gene SymbolVkorc1
Alternate namesvitamin K epoxide reductase complex subunit 1; Warfarin resistance; phylloquinone epoxide reductase; vitamin K1 2,3-epoxide reductase subunit 1; vitamin K1 epoxide reductase (warfarin-sensitive);
Chromosome1
Map Location1q36
EC Number1.1.4.1
SummaryVitamin K is essential for blood clotting but must be enzymatically activated. This enzymatically activated form of vitamin K is a reduced form required for the carboxylation of glutamic acid residues in some blood-clotting proteins. The product of this gene encodes the enzyme that is responsible for reducing vitamin K 2,3-epoxide to the enzymatically activated form. Fatal bleeding can be caused by vitamin K deficiency and by the vitamin K antagonist warfarin, and it is the product of this gene that is sensitive to warfarin. In humans, mutations in this gene can be associated with deficiencies in vitamin-K-dependent clotting factors and, in humans and rats, with warfarin resistance. [provided by RefSeq, Jul 2008]
OrthologsView orthologs and multiple alignments for Vkorc1

Proteins

vitamin K epoxide reductase complex subunit 1 precursor
Refseq ID:NP_976080
Protein GI:42627871
UniProt ID:Q6TEK4
mRNA ID:NM_203335
Length:161
RefSeq Status:
MGTTWRSPGRLRLALCLAGLALSLYALHVKAARARNEDYRALCDVGTAISCSRVFSSRWGRGFGLVEHVLGADSILNQSNSIFGCMFYTIQLLLGCLRGR
WASILLILSSLVSVAGSLYLAWILFFVLYDFCIVCITTYAINAGLMLLSFQKVPEHKVKKP
 

sig_peptide: 1..31
inference: COORDINATES: ab initio prediction:SignalP:4.0
calculated_mol_wt: 3340
peptide sequence: 
MGTTWRSPGRLRLALCLAGLALSLYALHVKA