LIPID MAPSĀ® Gene/Proteome Database (LMPD)

Introduction | Overview of Interfaces | Browse | Search | Download

LMPD Record

LMP003644

Record overview

LMPD IDLMP003644
Gene ID11727
SpeciesMus musculus(Mouse)
Gene Nameangiogenin, ribonuclease, RNase A family, 5
Gene SymbolAng
SynonymsAI385586; Ang1; Rnase5; Rnase5a
Alternate namesangiogenin; RNase 5; angiogenin-1; ribonuclease 5; angiogenin, ribonuclease A family, member 1
Chromosome14
Map Location14 B-C1|14 26.37 cM
EC Number3.1.27.-
SummaryThis gene encodes a member of the pancreatic ribonuclease A superfamily and is a potent inducer of neovascularization. The encoded protein is a secreted multifunctional tRNA-specific ribonuclease that promotes angiogenesis in response to angiogenetic stimuli such as hypoxia, mediates stress-induced translational repression by cleaving cellular tRNAs, stimulates cell proliferation by mediating rRNA transcription in prostate cancer cells, and is involved in neurite pathfinding. This gene resides in a cluster of highly related genes. It shares dual promoters and 5' exons with the ribonuclease, RNase A family 4 gene. Two alternatively spliced variants, with different 5' exons but the same coding exon, have been identified. Multiple pseudogenes have been found for this gene. [provided by RefSeq, Jun 2009]
OrthologsView orthologs and multiple alignments for Ang

Proteins

angiogenin precursor
Refseq ID:NP_001155203
Protein GI:239835771
UniProt ID:P21570
mRNA ID:NM_001161731
Length:145
RefSeq Status:REVIEWED
MAISPGPLFLIFVLGLVVIPPTLAQDDSRYTKFLTQHHDAKPKGRDDRYCERMMKRRSLTSPCKDVNTFIHGNKSNIKAICGANGSPYRENLRMSKSPFQ
VTTCKHTGGSPRPPCQYRASAGFRHVVIACENGLPVHFDESFFSL
 
angiogenin precursor
Refseq ID:NP_031473
Protein GI:6680688
UniProt ID:P21570
mRNA ID:NM_007447
Length:145
RefSeq Status:REVIEWED
Protein sequence is identical to GI:239835771 (mRNA isoform)
 
sig_peptide: 1..24
inference: COORDINATES: ab initio prediction:SignalP:4.0
calculated_mol_wt: 2479
peptide sequence: 
MAISPGPLFLIFVLGLVVIPPTLA

mat_peptide: 25..145
product: angiogenin
calculated_mol_wt: 13767
peptide sequence: 
QDDSRYTKFLTQHHDAKPKGRDDRYCERMMKRRSLTSPCKDVNTFIHGNKSNIKAICGANGSPYRENLRMSKSPFQVTTCKHTGGSPRPPCQYRASAGFR
HVVIACENGLPVHFDESFFSL sig_peptide: 1..24 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2479 peptide sequence: MAISPGPLFLIFVLGLVVIPPTLA mat_peptide: 25..145 product: angiogenin calculated_mol_wt: 13767 peptide sequence: QDDSRYTKFLTQHHDAKPKGRDDRYCERMMKRRSLTSPCKDVNTFIHGNKSNIKAICGANGSPYRENLRMSKSPFQVTTCKHTGGSPRPPCQYRASAGFR
HVVIACENGLPVHFDESFFSL