LIPID MAPSĀ® Gene/Proteome Database (LMPD)

Introduction | Overview of Interfaces | Browse | Search | Download

LMPD Record

LMP002663

Record overview

LMPD IDLMP002663
Gene ID8706
SpeciesHomo sapiens (Human)
Gene Namebeta-1,3-N-acetylgalactosaminyltransferase 1 (globoside blood group)
Gene SymbolB3GALNT1
SynonymsB3GALT3; GLCT3; GLOB; Gb4Cer; P; P1; beta3Gal-T3; galT3
Chromosome3
Map Location3q25
EC Number2.4.1.79
SummaryThis gene is a member of the beta-1,3-galactosyltransferase (beta3GalT) gene family. This family encodes type II membrane-bound glycoproteins with diverse enzymatic functions using different donor substrates (UDP-galactose and UDP-N-acetylglucosamine) and different acceptor sugars (N-acetylglucosamine, galactose, N-acetylgalactosamine). The beta3GalT genes are distantly related to the Drosophila Brainiac gene and have the protein coding sequence contained in a single exon. The beta3GalT proteins also contain conserved sequences not found in the beta4GalT or alpha3GalT proteins. The carbohydrate chains synthesized by these enzymes are designated as type 1, whereas beta4GalT enzymes synthesize type 2 carbohydrate chains. The ratio of type 1:type 2 chains changes during embryogenesis. By sequence similarity, the beta3GalT genes fall into at least two groups: beta3GalT4 and 4 other beta3GalT genes (beta3GalT1-3, beta3GalT5). The encoded protein of this gene does not use N-acetylglucosamine as an acceptor sugar at all. Multiple transcript variants that are alternatively spliced in the 5' UTR have been described; they all encode the same protein. [provided by RefSeq, Jul 2008]
OrthologsView orthologs and multiple alignments for B3GALNT1

Proteins

UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 1
Refseq ID:NP_149357
Protein GI:15451875
UniProt ID:Q8TDY1
mRNA ID:NM_033167
Length:331
RefSeq Status:REVIEWED
MASALWTVLPSRMSLRSLKWSLLLLSLLSFFVMWYLSLPHYNVIERVNWMYFYEYEPIYRQDFHFTLREHSNCSHQNPFLVILVTSHPSDVKARQAIRVT
WGEKKSWWGYEVLTFFLLGQEAEKEDKMLALSLEDEHLLYGDIIRQDFLDTYNNLTLKTIMAFRWVTEFCPNAKYVMKTDTDVFINTGNLVKYLLNLNHS
EKFFTGYPLIDNYSYRGFYQKTHISYQEYPFKVFPPYCSGLGYIMSRDLVPRIYEMMGHVKPIKFEDVYVGICLNLLKVNIHIPEDTNLFFLYRIHLDVC
QLRRVIAAHGFSSKEIITFWQVMLRNTTCHY
 
UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 1
Refseq ID:NP_001033717
Protein GI:84452146
UniProt ID:Q8TDY1
mRNA ID:NM_001038628
Length:331
RefSeq Status:REVIEWED
Protein sequence is identical to GI:15451875 (mRNA isoform)
 
UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 1
Refseq ID:NP_003772
Protein GI:4502343
UniProt ID:Q8TDY1
mRNA ID:NM_003781
Length:331
RefSeq Status:REVIEWED
Protein sequence is identical to GI:15451875 (mRNA isoform)
 
UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 1
Refseq ID:NP_149359
Protein GI:15451879
UniProt ID:Q8TDY1
mRNA ID:NM_033169
Length:331
RefSeq Status:REVIEWED
Protein sequence is identical to GI:15451875 (mRNA isoform)
 
UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 1
Refseq ID:NP_149358
Protein GI:15451877
UniProt ID:Q8TDY1
mRNA ID:NM_033168
Length:331
RefSeq Status:REVIEWED
Protein sequence is identical to GI:15451875 (mRNA isoform)