LIPID MAPSĀ® Gene/Proteome Database (LMPD)

Introduction | Overview of Interfaces | Browse | Search | Download

LMPD Record

LMP000461

Record overview

LMPD IDLMP000461
Gene ID7923
SpeciesHomo sapiens (Human)
Gene Namehydroxysteroid (17-beta) dehydrogenase 8
Gene SymbolHSD17B8
SynonymsD6S2245E; FABG; FABGL; H2-KE6; HKE6; KE6; RING2; SDR30C1; dJ1033B10.9
Alternate namesestradiol 17-beta-dehydrogenase 8; ke-6; protein Ke6; 17-beta-HSD 8; estrogen 17-oxidoreductase; testosterone 17-beta-dehydrogenase 8; really interesting new gene 2 protein; 17-beta-hydroxysteroid dehydrogenase 8; 3-oxoacyl-[acyl-carrier-protein] reductase; short chain dehydrogenase/reductase family 30C, member 1
Chromosome6
Map Location6p21.3
EC Number1.1.1.62
SummaryIn mice, the Ke6 protein is a 17-beta-hydroxysteroid dehydrogenase that can regulate the concentration of biologically active estrogens and androgens. It is preferentially an oxidative enzyme and inactivates estradiol, testosterone, and dihydrotestosterone. However, the enzyme has some reductive activity and can synthesize estradiol from estrone. The protein encoded by this gene is similar to Ke6 and is a member of the short-chain dehydrogenase superfamily. An alternatively spliced transcript of this gene has been detected, but the full-length nature of this variant has not been determined. [provided by RefSeq, Jul 2008]
OrthologsView orthologs and multiple alignments for HSD17B8

Proteins

estradiol 17-beta-dehydrogenase 8
Refseq ID:NP_055049
Protein GI:15277342
UniProt ID:Q92506
mRNA ID:NM_014234
Length:261
RefSeq Status:REVIEWED
MASQLQNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQETVRLLGGPGSKEGPPRGNHAAFQADVSEARAARCLLEQVQACFSRPPSVV
VSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCRGSIINISSIVGKVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPG
FIATPMTQKVPQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGYITGTSVEVTGGLFM