LMPD Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
LMP012577

Record overview

LMPD IDLMP012577
Gene ID29326
SpeciesMacaca mulata (Rhesus monkey)
Gene Nameglutathione peroxidase 2
Gene SymbolGpx2
SynonymsGPX-GI; GSHPx-2; GSHPx-GI;
Alternate namesglutathione peroxidase 2; GPx-2; glutathione peroxidase-gastrointestinal;
Chromosome6
Map Location6q24
SummaryThis gene product belongs to the glutathione peroxidase family, which functions in the detoxification of hydrogen peroxide. It contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon, which normally signals translation termination. The 3' UTR of Sec-containing genes have a common stem-loop structure, the sec insertion sequence (SECIS), which is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. Knockout studies in mice indicate that mRNA expression and activity of this enzyme are induced by luminal microflora, suggesting a role for this peroxidase in preventing inflammation in the GI tract. [provided by RefSeq, Jul 2008]
OrthologsView orthologs and multiple alignments for Gpx2

Proteins

glutathione peroxidase 2
Refseq ID:NP_899653
Protein GI:145275176
UniProt ID:
mRNA ID:NM_183403
Length:190
RefSeq Status:
MAYIAKSFYDLSAIGLDGEKIDFNTFRGRAVLIENVASLUGTTTRDYTQLNELQCRFPRRLVVLGFPCNQFGHQENCQNEEILNSLKYVRPGGGFQPTFS
LTQKCDVNGQNQHPVFAYLKDKLPYPYDDPFSLMTDPKLIIWSPVRRSDVSWNFEKFLIGPEGEPFRRYSRTFQTINIEPDIKRLLKVAI