LMPD Database

LMP006758

Record overview

LMPD IDLMP006758
Gene ID653308
SpeciesHomo sapiens (Human)
Gene NameN-acylsphingosine amidohydrolase (non-lysosomal ceramidase) 2B
Gene SymbolASAH2B
SynonymsASAH2C; ASAH2L; bA449O16.3
Alternate namesputative inactive neutral ceramidase B; ASAH2-like protein; putative inactive non-lysosomal ceramidase B; putative inactive N-acylsphingosine amidohydrolase 2B
Chromosome10
Map Location10q11.23
OrthologsView orthologs and multiple alignments for ASAH2B

Proteins

putative inactive neutral ceramidase B
Refseq ID:NP_001072984
Protein GI:118442845
UniProt ID:P0C7U1
mRNA ID:NM_001079516
Length:165
RefSeq Status:PROVISIONAL
MRQHRQFMDRTHYLLTFSSSETLLRLLLRIVDRAPKGRTFGDVLQPAKPEYRVGEVAEVIFVGANPKNSVQNQTHQTFLTVEKYEATSTSWQIVCNDASW
ETRFYWHKGLLGLSNATVEWHIPDTAQPGIYRIRYFGHNRKQDILKPAVILSFEGTSPAFEVVTI