LMPD Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
LMP006250

Record overview

LMPD IDLMP006250
Gene ID14776
SpeciesMus musculus(Mouse)
Gene Nameglutathione peroxidase 2
Gene SymbolGpx2
SynonymsGI-GPx; GPx-GI; GSHPx-2; GSHPx-GI
Alternate namesglutathione peroxidase 2; GPx-2; intestinal GPx; glutathione peroxidase-gastrointestinal
Chromosome12
Map Location12 C3|12 33.73 cM
EC Number1.11.1.9
SummaryThis gene product belongs to the glutathione peroxidase family, which functions in the detoxification of hydrogen peroxide. It contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon, which normally signals translation termination. The 3' UTR of Sec-containing genes have a common stem-loop structure, the sec insertion sequence (SECIS), which is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. Knockout studies in mice indicate that mRNA expression and activity of this enzyme are induced by luminal microflora, suggesting a role for this peroxidase in preventing inflammation in the GI tract. [provided by RefSeq, Jul 2008]
OrthologsView orthologs and multiple alignments for Gpx2

Proteins

glutathione peroxidase 2
Refseq ID:NP_109602
Protein GI:145275168
UniProt ID:Q9JHC0
mRNA ID:NM_030677
Length:190
RefSeq Status:REVIEWED
MAYIAKSFYDLSAVGLDGEKIDFNTFRGRAVLIENVASLUGTTTRDYNQLNELQCRFPRRLVVLGFPCNQFGHQENCQNEEILNSLKYVRPGGGYQPTFS
LTQKCDVNGQNEHPVFAYLKDKLPYPYDDPFSLMTDPKLIIWSPVRRSDVSWNFEKFLIGPEGEPFRRYSRSFQTINIEPDIKRLLKVAI