LMPD Database

LMP001878

Record overview

LMPD ID	LMP001878
Gene ID	2879
Species	Homo sapiens (Human)
Gene Name	glutathione peroxidase 4
Gene Symbol	GPX4
Synonyms	GPx-4; GSHPx-4; MCSP; PHGPx; snGPx; snPHGPx
Alternate names	phospholipid hydroperoxide glutathione peroxidase, mitochondrial; phospholipid hydroperoxidase; sperm nucleus glutathione peroxidase
Chromosome	19
Map Location	19p13.3
EC Number	1.11.1.12
Summary	This gene encodes a member of the glutathione peroxidase protein family. Glutathione peroxidase catalyzes the reduction of hydrogen peroxide, organic hydroperoxide, and lipid peroxides by reduced glutathione and functions in the protection of cells against oxidative damage. Human plasma glutathione peroxidase has been shown to be a selenium-containing enzyme and the UGA codon is translated into a selenocysteine. The encoded protein has been identified as a moonlighting protein based on its ability to serve dual functions as a peroxidase as well as a structural protein in mature spermatozoa. Through alternative splicing and transcription initiation, rat produces proteins that localize to the nucleus, mitochondrion, and cytoplasm. In humans, alternative transcription initiation and the cleavage sites of the mitochondrial and nuclear transit peptides need to be experimentally verified. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014]
Orthologs	View orthologs and multiple alignments for GPX4

Proteins

phospholipid hydroperoxide glutathione peroxidase, mitochondrial isoform A precursor

Refseq ID:	NP_002076
Protein GI:	75709200
UniProt ID:	P36969
mRNA ID:	NM_002085
Length:	197
RefSeq Status:	REVIEWED

`MSLGRLCRLLKPALLCGALAAPGLAGTMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAF PCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF`

sig_peptide: 1..25
inference: COORDINATES: ab initio prediction:SignalP:4.0
calculated_mol_wt: 2509
peptide sequence: 
MSLGRLCRLLKPALLCGALAAPGLA

sig_peptide: 1..25
inference: COORDINATES: ab initio prediction:SignalP:4.0
calculated_mol_wt: 2509
peptide sequence: 
MSLGRLCRLLKPALLCGALAAPGLA

phospholipid hydroperoxide glutathione peroxidase, mitochondrial isoform B precursor

Refseq ID:	NP_001034936
Protein GI:	90903238
UniProt ID:	P36969
mRNA ID:	NM_001039847
Length:	227
RefSeq Status:	REVIEWED

phospholipid hydroperoxide glutathione peroxidase, mitochondrial isoform C precursor
`MSLGRLCRLLKPALLCGALAAPGLAGTMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAF PCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFGHRLSTVPHRQERLRGEALRTHGGAPGDREGP APLFLAPQVCGPARAPAHALGAFHRHS`

Refseq ID:	NP_001034937
Protein GI:	90903240
UniProt ID:	Q6PI42
mRNA ID:	NM_001039848
Length:	234
RefSeq Status:	REVIEWED

`MGRAGAGSPGRRRQRCQSRGRRRPRAPRRRKAPACRRRRARRRRKKPCPRSLRPEIHECPKSQDPCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFV CIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKW NFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF`